KEGG   Buchnera aphidicola Sg (Schizaphis graminum): BUsg_295Help
Entry
BUsg_295          CDS       T00087                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bas  Buchnera aphidicola Sg (Schizaphis graminum)
Pathway
bas00010  Glycolysis / Gluconeogenesis
bas00030  Pentose phosphate pathway
bas00051  Fructose and mannose metabolism
bas00680  Methane metabolism
bas01100  Metabolic pathways
bas01110  Biosynthesis of secondary metabolites
bas01120  Microbial metabolism in diverse environments
bas01130  Biosynthesis of antibiotics
bas01200  Carbon metabolism
bas01230  Biosynthesis of amino acids
bas03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:bas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUsg_295 (pfkA)
   00030 Pentose phosphate pathway
    BUsg_295 (pfkA)
   00051 Fructose and mannose metabolism
    BUsg_295 (pfkA)
   00052 Galactose metabolism
    BUsg_295 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    BUsg_295 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BUsg_295 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bas01009]
    BUsg_295 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bas03019]
    BUsg_295 (pfkA)
Enzymes [BR:bas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BUsg_295 (pfkA)
Protein phosphatases and associated proteins [BR:bas01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BUsg_295 (pfkA)
Messenger RNA biogenesis [BR:bas03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BUsg_295 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AAM67850
UniProt: Q8K9N0
Position
338920..339882
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEKLEVFGIYDGYLGLYENRMTLLDRYSVSD
MINRGGTFLGSARFPGFYKNEIRTIAVNNLNKRNIDALVVIGGDGSYIGAQKLTKMGIPC
ISIPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTLA
AAIAGGCEFIVLPEIHYKKEELVSEIQAGIEKGKKHAIVAITEYICDVEKLAKYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYAVELLIEGYKGKCVGIQNEKMVFNDITDA
LKNMKRVFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagatcggagtattaactagtggtggagatgctcctgggatgaatgctgcg
attagaggtgtagtaagaacagcattgagtgaaaaattagaagtatttggtatttatgat
ggatatttaggtctatatgaaaatcgtatgacattgttagatagatatagtgtttctgat
atgattaatagaggcggaacatttttaggatctgctcgatttcctggcttttacaaaaat
gaaatacgtactattgcagtaaataatttaaataaaagaaatatagatgctcttgttgtt
atcggcggtgatggatcttatataggagcacaaaaattaacgaaaatgggaattccatgt
attagtattccaggtacaatagacaacgatgtagcaggtactgattacacgataggttat
tttacagccttagagacagtggttgaagcgattgatagattaagagatacttcttcttct
catcaaagaatttctattgtagaagttatggggcgatactgcggagatttaacattagct
gctgcaatagcaggtggttgcgaatttattgttcttccagaaattcattataaaaaagaa
gaattggtttctgaaattcaggcaggaatcgaaaaagggaaaaaacatgcaatagtcgca
ataacagaatatatttgtgatgtagaaaaattagcgaaatatattgagaagaaaaccaat
agagagacaagagctacaattttaggacatatccagagaggaggagcaccagtagtatat
gatagaattcttgcttcaagaatgggagcatatgcagtagaattgctgatagaaggctac
aaagggaaatgtgttggaatacaaaatgaaaaaatggtatttaacgacataacagatgcg
ttaaaaaatatgaaacgtgtttttaaaaaagattggttaattacagctaaaaagttatac
taa

DBGET integrated database retrieval system