KEGG   Bifidobacterium asteroides: BAST_0359Help
Entry
BAST_0359         CDS       T02271                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00051  Fructose and mannose metabolism
bast00520  Amino sugar and nucleotide sugar metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAST_0359
   00520 Amino sugar and nucleotide sugar metabolism
    BAST_0359
Enzymes [BR:bast01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BAST_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer IspD
Motif
Other DBs
NCBI-ProteinID: AFU70954
UniProt: K4IKQ6
Position
477581..478705
Genome map
AA seq 374 aa AA seqDB search
MDLNDFYAVIPAGGVGTRLWPLSRQDRPKFLYDLLGSGRTMIQGTFDRLAGICGTDHVVV
STGQRHVDQVRQQLPDLAEDALFAEPVPRDSTAAIALATAVLAQRHGGEIIVGSFAADHV
IRDDKAFAASVGQAVAAARAGYVTTIGIAASRPSTAFGYIHQGPSLADRIPGAPDARLVS
EFVEKPDASTAQAYLSTGEYRWNAGMFVMQAQVLLDCLRRYKPELHAAVMAIAQVWDQGG
QARSQAMEEHWPGIEKIAFDYAVAEPLSAAGGVAVVPGGFDWDDIGDFNSVAGLLPSSNR
RNIKILGDADRVMYLDSAGDMVVPGSERTVALLGVDDMIVVDTPDALLVAPRARSQEVKD
MVAKLAQYGCDDIL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaatgatttctatgccgtcattccggccggtggcgtgggtacccggctctgg
ccattgagccgccaggaccggcccaagttcctctacgatctgttggggtcaggcagaaca
atgatccagggcacctttgaccggctggctggcatctgcgggaccgatcatgtggtcgtc
tccactggccagcggcatgtggatcaggtgcgtcagcagcttcctgatctggctgaggac
gcgctcttcgccgagcctgttcctcgcgattccacggcggccattgccctggctactgct
gtgctggcacagcggcacggcggggaaatcatcgtgggctccttcgccgccgaccacgtc
atccgagacgacaaggcgtttgcggcctcagtggggcaggcggtggcagcggcccgagcc
gggtatgtgaccaccatcggcatcgccgcctcccgtccctccaccgccttcggctacatc
caccaaggcccttccctggccgatcgcattcccggggcccctgatgcccgcttggtcagc
gaattcgtcgagaagccggatgcctctacggcacaggcctacctgtcaacaggagagtat
cgctggaatgccggcatgttcgtcatgcaggcgcaggtgctcctggattgccttcgtcgt
tacaagccggagctccacgccgccgtcatggccatcgcccaggtctgggatcagggtggg
caggctcgtagccaggctatggaggagcattggccgggcatcgagaagattgccttcgac
tatgccgtggccgagcccctatcggcggctggcggcgtggcggttgttcccgggggtttc
gattgggatgacatcggcgacttcaattcagtggcgggtctgctgccgtcctccaacagg
cgcaacatcaagattcttggggatgccgaccgggtcatgtatctggattccgctggggac
atggtcgtgccaggctccgaacgcacggtcgcccttctcggtgtggatgacatgatcgtc
gtcgacactcccgacgcgctcctggtggccccccgggcccgcagtcaggaagtcaaggac
atggtggccaagctggcccagtacggctgtgacgacatactctga

DBGET integrated database retrieval system