KEGG   Bifidobacterium asteroides: BAST_0421Help
Entry
BAST_0421         CDS       T02271                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BAST_0421
Enzymes [BR:bast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BAST_0421
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BAST_0421
    1.1.1.-  
     BAST_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 Cupin_2 3HCDH_N DUF2254
Motif
Other DBs
NCBI-ProteinID: AFU71015
UniProt: K4IZZ1
Position
complement(569802..570869)
Genome map
AA seq 355 aa AA seqDB search
MKALMYYGKEDVRLEDVPEPELKPGTIKIHPAFTGICGSDVHLYYDGAVNGGGNSPDHPH
PLTGETLPVVFGHEISGTVEAIADDVHTDMKVGDSVVVEAEIACGECPACKAGNYNDCDK
LAGIGINGGGGGLSEHIVVPAEHVFPVGDIPLDQAAMIEPFAVAHHAIRAMEPQEGQTAV
VGGAGPVGLLIGTILRAKGVRVIMSELSSARKEKALQSHSADIVVDPSKEDLAERVRQET
DEAGADLAFDAAGAEPVDHQLLEALKATGGLMVVALHGKPITLNLTKELGFGEKFIRGTM
GYANDHADAIKLIHDRNIDLSTFITDRIKVEDIVDKGFRQLREDAENHVKIIVSM
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattgatgtactacggcaaggaagatgtacgtctggaggacgtgcccgagcct
gagctcaagccgggaaccatcaagatccaccccgccttcaccggcatctgcggctccgat
gttcatctttactacgatggagcagtcaacgggggcgggaattcgcccgaccacccccat
cccctgacgggagagaccctgccggtggtcttcggccatgagatttcgggtaccgtcgag
gcgatcgccgatgatgtgcacacggatatgaaggtgggcgactcggtggtcgtcgaggcc
gaaatcgcatgtggcgaatgcccggcctgcaaggccggcaactacaatgactgcgacaag
ctggccggaatcggcatcaacggaggcggcggcggactgagcgagcatatcgtggttccg
gcggagcatgtcttccccgtgggcgacatccccctggatcaggctgccatgatcgagccc
ttcgccgtggcccatcacgccatccgtgccatggaaccccaagaaggccagaccgcagtg
gtcggaggcgccgggccggtgggattgctcatcggcaccattctgcgcgcaaagggagtc
cgggtgatcatgtccgaactctcctcagcccgtaaggagaaggccctgcagtcgcattcg
gccgacatcgtggtcgatcccagcaaagaggacctggcggagagggtccgccaggaaacc
gacgaagccggggctgacctggccttcgatgcagcaggggcagagcctgtcgaccaccag
cttctggaggctttgaaggccaccggcggactcatggtcgtggccctgcatggcaagccc
atcacgctgaacctgaccaaggagctgggcttcggagagaagttcatccgcggcaccatg
ggatacgcgaacgatcatgccgatgccatcaagctcatccatgaccggaacatcgacctg
tccaccttcatcaccgacaggatcaaggtcgaggacatcgtggacaagggcttccgccag
ctgcgtgaggacgcggaaaaccatgtcaagatcatcgtgagcatgtaa

DBGET integrated database retrieval system