KEGG   Bifidobacterium asteroides: BAST_0685Help
Entry
BAST_0685         CDS       T02271                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00260  Glycine, serine and threonine metabolism
bast00750  Vitamin B6 metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01230  Biosynthesis of amino acids
Module
bast_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAST_0685
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAST_0685
Enzymes [BR:bast01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAST_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AFU71272
UniProt: K4IKZ7
Position
complement(930802..932283)
Genome map
AA seq 493 aa AA seqDB search
MSTYHSTRGDREQLQSKQAIRRGLAPDGGLYVSDGLDALTIDPATVAGLDYRGTAILVLS
GLLSDYSSAQLDSCLDAAYGEQWSDPAITPLVDLGGNDFVLELFRGPTSAFKDVALQLLP
RLMALAGEDGERIMVLTATSGDTGKAALAGFADAPGTGITVFYPQGKVSQIQRLQMVTQQ
GGNLQVCAVRGNFDDAQSAVKSIFADTDLARELEEKASTVLSSANSINVGRLAPQVVYYF
RAYGSLMERGVIRPGDPVEFCVPTGNFGDVLAGYYAKMMGLPVARLTVASDRNRVLNDFL
TTGVYDRNRPFYTTTSPSMDILISSNLERMLYYMADGDTKLIASLMADLESTGRYQVPDD
MMTRIRGLFSCGWADEDQVASAISDCWEDRGYLIDPHTACGYQVMTGQTDRDPAVPRVLL
STASPYKFPRVVCQSLGLETPDSDFDCMDILAESTNTRPPKALRTLENAPVRFQDCIDPG
DMSDYVRHAVIQS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcacataccacagcacccgaggcgacagggagcagctgcagtccaagcaggccatc
agacggggcctggcccctgacggcggactctacgtcagcgatggactggacgcactgacc
atcgaccctgccacggttgccggcctggactacaggggcacggccatactggtcctttcg
ggactgctgagcgattactcttccgctcagctggactcctgcctggacgcagcctacgga
gaacagtggtccgatccggcaataacccctctggtggacctgggcggcaacgacttcgta
ctggagctcttccgcgggcccacctcggccttcaaggatgtggccttgcagcttctgccg
agactgatggccctggccggggaggatggcgaacggatcatggtgctcaccgccacctcc
ggagacacgggcaaggcggcgctggccggattcgcagacgcgccgggcacgggcatcact
gttttctatcctcagggcaaggtcagtcagattcagcgcctgcagatggtcacccagcag
ggcggcaacctgcaggtctgtgcggttcggggcaatttcgacgatgcccagtccgcagtc
aagtccatcttcgccgacaccgatctggctcgtgaactggaggagaaggcctcgaccgtc
ctctcctcggccaactccatcaacgtgggccgcctggctccgcaggtcgtctactacttc
cgggcctacgggtccctgatggaacgaggggtgatcagacccggggatccggtcgaattc
tgcgtgcccaccggcaacttcggcgatgtgctggccggatactacgccaagatgatgggg
cttccggtggcccgcctgaccgtggcctcggaccgcaaccgggtcctcaacgatttcctg
accacaggcgtctatgaccgcaaccgccccttctacaccaccacctcccccagcatggac
atcctgatctcctccaacctggaacggatgctctactacatggccgacggcgacaccaaa
ctgattgcctcgcttatggccgatctggagtccacgggacgctatcaggtgcctgatgac
atgatgaccagaatccgcgggctcttctcctgcggctgggccgacgaggaccaggtggcc
tcagccatcagcgactgctgggaggaccggggatacctgatcgatccgcacacggcctgc
ggctaccaggtcatgaccgggcagaccgacagggatcctgccgtgccccgggtgctgctg
tccacagccagcccctacaagttcccccgggtggtctgccaatccctgggcctggagacc
ccggacagcgacttcgactgcatggacatcctggccgagtccaccaacaccaggcccccc
aaggctctgcgcaccctggaaaacgcacctgtacgcttccaggactgcatcgatccaggg
gacatgtccgactacgtccgccacgcggtcatacagtcctga

DBGET integrated database retrieval system