KEGG   Bifidobacterium asteroides: BAST_0696Help
Entry
BAST_0696         CDS       T02271                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00561  Glycerolipid metabolism
bast00640  Propanoate metabolism
bast01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bast00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAST_0696
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BAST_0696
Enzymes [BR:bast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BAST_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AFU71283
UniProt: K4IN98
Position
942398..943483
Genome map
AA seq 361 aa AA seqDB search
MRKVLCSPGSYVQQEGAMGKLAGEYAALGTKGAHLIVDPVIDGLYHDDIVASFEHDGIPY
ELMKFGGECSMEEVDRHRAHLGDSDAVIGIGGGKTLDTAKAVAHFAHLPVMIVPTAASSD
APCSRLSVLYTPEGVFDRYLPLPANPNVVLMDTDVIAKAPVRFLVSGLGDAFATYYEAAA
CVQSNAVTMTGGHATMAAFALARLCRDTLLEDGVKAVAAAKAGVRTAALEKIIEANTLLS
GLGFESSGLAAAHAIHDGMTALEGTHSMLHGEKVAFGTLAQLVLEDHPLEETRRVYGFFR
SVGLPTSLEQIGIGQASEEDLLKVGEHACGPDETMGNMPFEVTPTDVAHALRAADQLGKQ
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaggttctgtgctctccgggctcctatgttcagcaggagggcgccatgggaaag
ctggccggggaatacgcggctctgggcaccaagggcgcccatctgatcgtcgatccggtc
atcgacgggctctaccacgacgacattgtcgcctcctttgagcacgatgggatcccctac
gaactgatgaaattcggcggcgagtgctccatggaggaggtcgaccgccatcgtgcccat
ttgggcgacagcgacgcagtgatcggcataggtggcggcaagaccttggataccgccaag
gccgtggcccacttcgcccacctgccggtcatgattgtgcccacggcggcttcatcggat
gcgccctgctcaaggctctctgtgctctacacgcctgagggtgttttcgaccgttatctg
cccctgcctgccaacccgaacgtggtcctgatggataccgacgttatcgccaaggccccg
gtgcgcttcctggtatcagggctgggcgatgccttcgccacctactatgaggcggctgcc
tgcgtgcagtcgaacgcggtgaccatgaccggggggcacgccaccatggccgccttcgcc
ctggcccgtctctgccgcgacaccctgctggaggatggggtcaaggccgtggccgctgcc
aaggccggtgtgcgcacagccgctcttgagaagatcatcgaggccaacaccctgctgagc
ggtctgggcttcgagagctccggtctggctgccgcccacgccattcatgacgggatgacc
gccctggagggcacccactccatgctgcacggagaaaaggtggccttcggcaccctggca
cagctggtccttgaggatcaccccctggaggagacccgcagggtctacggcttcttccgt
agcgtgggtctgcccacctccctggagcagatcggcatcggccaggccagtgaggaggat
ctgctcaaggtcggcgagcacgcctgcggtcctgacgagaccatgggcaacatgcccttc
gaggtgaccccgaccgatgtggctcacgccctgcgtgcagccgatcagctgggcaagcag
ctctga

DBGET integrated database retrieval system