KEGG   Bifidobacterium asteroides: BAST_0731Help
Entry
BAST_0731         CDS       T02271                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00260  Glycine, serine and threonine metabolism
bast00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01130  Biosynthesis of antibiotics
bast01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAST_0731
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAST_0731
Enzymes [BR:bast01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAST_0731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Glyco_tranf_2_4 BtpA
Motif
Other DBs
NCBI-ProteinID: AFU71318
UniProt: K4INE0
Position
984851..985741
Genome map
AA seq 296 aa AA seqDB search
MVNQQWQWQKAPAQPVQPKGFSSAASPVASTLQALRQQGRPAFIGYFPYGFPDVPTSLEA
MRVMVKNGVDIVEIGLPYSDPVMDGPVIQAASKCAIDNGVKVEGVFDAVRQVQADGARAL
VMSYWNLILHHGVADFAQRMAEAGGSGLVTPDLIVDESGEWIEQSDRYGLDRVYLVSPDS
TDARLQLTSRAARGFVYATSRMGVTGERTSMSNSAQNLVARVRHAGAPYVCVGIGVSTAQ
QASQVGAYADGVIVGSALVHCLLDDEGRPRKDRRKALEALAEVCSDLRWGISQARK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccagcaatggcaatggcagaaagcccccgcccagcccgtccagcccaagggg
ttcagctctgcggccagcccggtggcatccacgctgcaggccctccgccagcaaggcaga
cccgctttcatcggctacttcccctatggattccccgacgtgcccacatccctggaggcc
atgcgggtcatggtgaaaaacggggtcgacatcgtcgagatcggactgccctacagcgac
ccggtcatggatggcccggtcatccaggcggccagcaagtgcgccatcgacaatggtgtc
aaggtcgaaggcgtcttcgatgcggtccgacaggtccaggcggacggtgcaagggctctg
gtcatgagctactggaatctgattctgcaccatggggtagcggactttgctcaacgcatg
gccgaagccggaggatccgggctggtcaccccggatctgatcgtcgacgaatccggggaa
tggatagagcagtcggaccgctatggcctcgaccgggtctatctggtctcgcccgactcc
accgatgcacgtctgcagctcacctcccgagctgccagaggcttcgtctacgcgacatcc
cggatgggtgtgaccggagagcgaaccagcatgtccaactcggcccagaacctggtggcg
agagtcaggcatgcgggcgctccttatgtgtgcgtgggcatcggggtttcgaccgcccag
caggcctcccaggtcggcgcatacgcggacggggtcatcgtcggatcggccctggttcac
tgtcttctggatgacgagggcaggccgcggaaggaccgcagaaaggcactggaggccttg
gctgaggtttgctctgatctgcgttggggcatctcccaggccaggaagtga

DBGET integrated database retrieval system