KEGG   Bifidobacterium asteroides: BAST_1073Help
Entry
BAST_1073         CDS       T02271                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00010  Glycolysis / Gluconeogenesis
bast00520  Amino sugar and nucleotide sugar metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01130  Biosynthesis of antibiotics
bast01200  Carbon metabolism
Module
bast_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAST_1073
   00520 Amino sugar and nucleotide sugar metabolism
    BAST_1073
Enzymes [BR:bast01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BAST_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFU71651
UniProt: K4IRE1
Position
complement(1406729..1407499)
Genome map
AA seq 256 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTIGDFAEPRKKILTPEHSTPEAVGVVVKELLDRFEV
PSDVPVGIAFPAPVKPDKPLDFMANLDQSWVGTNVQEVLSKACGRPVSVVNDADAAGLAE
VQYGAAKGQKGLVIATTLGTGIGTALIYNGVLIPNSELGHLTLDGKDAEKYAASSVRDRK
KLSYKKWANRLTKYYRLLEHYFNPDFFVVGGGVSRMSEKFLPHIDIKTPIVAAKLRNQAG
IVGAAYLADLRQKHLG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacagcgcaggctttcggagtggatattggtggatccggtatcaaggctgcc
cctgttgacctgacaatcggtgattttgcagagcctcgcaagaaaattctcactcccgag
cactccacgcctgaggctgtgggggttgtcgtcaaggagctcttggatcgttttgaagtt
ccttcggatgtgcccgtgggcatcgccttcccggcccctgtcaagcccgacaagccgctc
gatttcatggccaacctggatcagtcctgggttggcaccaatgttcaggaggtcctttcc
aaggcctgcggtaggcccgttagcgtcgtcaacgatgcggatgctgccggtcttgccgag
gtgcagtacggggcggccaaagggcagaagggtctggtcatcgccacgacactgggcacc
ggcatcggtacggctctgatttataacggtgttctgattcccaacagtgagcttggtcac
ctgacgttggacggcaaggatgccgagaagtacgcagcttcatcggtgcgcgaccgcaag
aagctgagctacaaaaagtgggccaatcgactgaccaagtactaccgcctgcttgagcac
tacttcaatcccgatttcttcgtcgtcggcggcggggtcagccggatgagcgagaagttc
ctgcctcacatcgacatcaagacccccattgtggccgccaagctgcgcaaccaggccggc
atcgtgggtgccgcttatctggctgaccttcggcaaaagcacctggggtga

DBGET integrated database retrieval system