KEGG   Bifidobacterium asteroides: BAST_1355Help
Entry
BAST_1355         CDS       T02271                                 

Definition
(GenBank) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bast  Bifidobacterium asteroides
Pathway
bast00010  Glycolysis / Gluconeogenesis
bast00071  Fatty acid degradation
bast00350  Tyrosine metabolism
bast00620  Pyruvate metabolism
bast00625  Chloroalkane and chloroalkene degradation
bast00626  Naphthalene degradation
bast00650  Butanoate metabolism
bast01100  Metabolic pathways
bast01110  Biosynthesis of secondary metabolites
bast01120  Microbial metabolism in diverse environments
bast01130  Biosynthesis of antibiotics
bast01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bast00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAST_1355
   00620 Pyruvate metabolism
    BAST_1355
   00650 Butanoate metabolism
    BAST_1355
  Lipid metabolism
   00071 Fatty acid degradation
    BAST_1355
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAST_1355
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAST_1355
   00626 Naphthalene degradation
    BAST_1355
Enzymes [BR:bast01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAST_1355
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BAST_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AFU71924
UniProt: K4IND8
Position
complement(1715143..1717908)
Genome map
AA seq 921 aa AA seqDB search
MAGTQKQKHEQQMKDPAAGREGGRVDSSELASREVDALVVRAQSALRAFEELNQEQVDRI
VAKASIAALNKHLSLAQMAVEETGRGLVEDKATKNIFACEHVTNYLARQRTVGIIGENDV
DGIIEVAEPVGVVAGVTPVTNPTSTAIFKSLLALKTRCPIIFGFHPYAQRCSVEAARIVR
DAAIEAGAPQNCIQWIEHPSVEATGALMRHPGVATILATGGTGMVKAAYSSGKPALGVGA
GNAPAYVDRRVNVPRAVNDLILSKHFDYGMICATEQAIIAHQDVYDRVIQEMKRRKAYFV
NPEEKAMLEEYMFGVRAHAGADASAPRLNSEVPGKSPQFIARQAGFEIPEDATILAAQCD
QVGSVEPLTLEKLAPVQAVLKASNKEEGFTLCEQMLRYGAGHTAAIHTDDERLVHEYGQR
MHACRIVWNQPSSLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLINIKRIARRNS
NMQWFKVPPKTYFEPNSVRYLRDMFGIRRAVIVCDKVMEQLGIVDKIIDQLRARSEPVTF
RIIDYVEPEPSVETVERGAAMMRDEFRPDTIIAVGGGSPMDAAKIMWLLYEHPEISFADV
REKFFDIRKRAFKIPPLGTKARLVCIPTSSGTGSEVTPFAVITDHKTGYKYPVTDYALTP
SVAIVDPVLARTQPKSLACDSGFDALTHCMEAFVSVYANDYTDAMALHAAKLIWDNLEPA
VGTAGGEAKVRAQEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHVAHGRANSILLPY
VIRYNGRIPDEPTSWPKYSEYVAPERYRQMAHVLGIESATTEEGVELLARAVESYRDERL
GMDASFQAAGVDEGFYWKSLDQIGMRAYEDQCTPANPRIPLIEDMKDIAVAAYYGVSQEE
GHRMRVARQGEDMVQEASQRA
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
ttggctggaacgcagaagcagaagcatgagcaacaaatgaaggatccggcagcaggcagg
gaaggtggccgggtcgacagcagtgagctggccagcagggaggtggatgctctggtcgtc
cgcgcgcagtcggctttacgcgcctttgaggagctcaaccaggaacaggtggatcggatt
gtggccaaggcctcgatcgcggccctgaacaagcatctgtccctggcacagatggccgtg
gaggagaccgggcgcggtctggtggaggacaaggccaccaagaacatcttcgcctgcgag
catgtgaccaactacctggccaggcaacgcaccgtgggcatcatcggcgaaaacgacgtg
gacggcatcatcgaggtggccgagccggtgggtgtagtggctggcgtgactccggttacc
aaccccacctcgactgccattttcaagtcgttgctggccctgaagacccgctgccccatc
atcttcggattccacccctacgcccagcgctgttcggtggaggcggcccggatcgtccgc
gatgccgctatcgaggcaggcgctcctcagaattgcatccagtggatcgagcatccctca
gtcgaggccaccggcgcgctcatgcggcatcccggcgtggccaccattctggccaccgga
ggcaccggcatggtcaaggccgcctactcttcgggcaagcctgccctgggcgtaggagcc
ggcaatgcccctgcctatgtggaccgcagggtcaacgtccccagggccgtcaacgacctg
attctgtccaagcattttgactatggcatgatctgcgccacagagcaggccatcatcgcc
catcaggatgtgtatgaccgggtgatccaggagatgaagcggcgcaaggcctacttcgtc
aaccctgaggagaaggccatgctggaggagtacatgttcggcgtgcgggcccatgccggt
gccgatgcgtctgctcccaggctcaactccgaggttccgggcaagtccccccagttcatc
gcccgtcaggccggcttcgagatacccgaggatgcgaccatcctggctgcccaatgcgac
caggtcggctccgtggagcccctgaccttggagaagctggctccggttcaggctgtactc
aaggccagcaacaaggaggagggcttcaccctctgcgagcagatgctgcgctacggcgcc
gggcacacggcagccattcacaccgatgacgagaggctggtgcatgagtacggtcagcgc
atgcacgcctgccggatcgtctggaaccagcccagctccctgggtggcatcggcgacatc
tacaatgccatcgccccctccttgaccctgggctgcggctcctatggcggcaactcggtc
tcgggcaacgtccaggcggtcaatctgatcaacatcaagcggattgcgcggaggaacagc
aacatgcagtggttcaaggtgccccccaagacctacttcgagcccaactccgtccgctat
ttgcgcgacatgttcggcatccgacgtgccgtcatcgtctgtgacaaggtcatggagcag
ctggggatcgtggacaagatcatcgatcagctgcgggcccggtccgagccggtcaccttc
cggatcattgactacgtagagccggagcccagcgtcgagacggtggagcgcggtgcggcc
atgatgcgcgatgagttccgtcccgacacgattatcgccgtgggcggtggcagtcccatg
gacgcggccaagatcatgtggctgctctatgagcacccggagatctcctttgccgatgtc
cgggagaagttcttcgacatccgcaagcgggccttcaaaattccgcccctgggcaccaag
gccaggttggtctgcattcccacctcctcgggcacgggttcggaggtcaccccattcgcg
gtcatcaccgaccataagaccggatacaagtaccccgtcaccgactacgccctgactccc
agcgtggccatcgtggatccggttctggcccgtacccagcccaagagcctggcctgcgac
tcgggcttcgatgccctgacccactgcatggaggccttcgtctcggtctatgccaatgac
tacaccgacgccatggccctgcatgcggccaagctgatctgggacaacctggagcctgcc
gtaggcaccgccggcggcgaggccaaggtgcgcgcccaggagaagatgcataatgcggcg
accatggctggcatggccttcggttcggccttcctgggcatgtgccacggcatggcgcat
accatcggagccctctgccatgtggcccatgggcgcgccaactccatcctgctgccctat
gtgatccgttacaacggacggatcccggacgagccgaccagctggcccaagtacagcgag
tatgtggccccggagcgctacaggcagatggcacacgtactgggcatcgaatccgcaact
accgaggaaggcgtggagctcttggcccgtgctgtggaatcctaccgggacgagcgcctg
ggcatggatgcctccttccaggctgccggagtggacgagggcttctactggaagtccctg
gatcagatcggcatgcgcgcctatgaggatcagtgcacgcccgccaacccccgtattccg
ttgattgaggacatgaaggacatcgctgtggccgcctactatggggtcagccaggaggag
ggccaccggatgagggtcgcccgccaaggtgaggatatggtccaggaggcctcccagcgg
gcttga

DBGET integrated database retrieval system