KEGG   Bacillus anthracis Sterne: BAS3535
Entry
BAS3535           CDS       T00184                                 
Name
(GenBank) conserved hypothetical protein
Organism
bat  Bacillus anthracis Sterne
SSDB
Motif
Pfam: Phg_2220_C
Other DBs
NCBI-ProteinID: AAT55840
Position
complement(3500856..3501614)
AA seq 252 aa
MSNLLIHEEPLLVLPGLASRIGLNEAIFLQQIHYWLNRSKHFYDERNWVYNSVAEWVKQF
PFWSENTIRRIVKNLEDEQLLVIGNYNRAKFDKTKWYSINYEKLRLLESTNDVPNLGRRS
TQNGQMDVPNLGKPIPETNTETTSEIKEYIVEIVNYLNDVCGSSYRLTSKKTQTLIKTRL
VEGFTVDNFKTVIDTKAKEWLRTEQAKYLRPETLFGTKFEGYLQQGKVEGKHGSSKGNRY
SKDPFEEDDLPF
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagtaatttattaattcatgaagaaccattacttgttcttccaggactggcaagcaga
attggtttaaatgaggcgatatttctacaacagatacattattggctaaatagatctaag
catttttatgatgaaagaaactgggtatataacagtgtggcagaatgggttaaacaattt
ccgttttggagtgagaataccattagacgtattgtaaagaatttagaagatgaacagcta
cttgttataggtaattataatcgagctaagtttgataagacgaaatggtattccattaat
tatgaaaaactccgtttgttagaatccacaaacgatgtacccaacttgggtagacggtct
acccaaaatgggcaaatggatgtacccaatttgggtaaaccaataccagagactaacaca
gagactacatcagagattaaagaatatatagtcgagatagtaaactatctcaacgacgtg
tgtggtagtagttaccgtttaacatctaagaaaacacaaacattgattaaaactagatta
gtagaaggattcactgtggataacttcaaaactgtgattgatacaaaagctaaagaatgg
ctaagaacagaacaagcaaagtatctaagaccagaaacattatttggcacaaagtttgaa
ggctatttacaacaaggaaaggtggaaggaaaacatggctctagtaaaggtaacagatat
agcaaagaccctttcgaagaagatgatcttcctttctga

DBGET integrated database retrieval system