KEGG   Bacillus anthracis Sterne: BAS0037Help
Entry
BAS0037           CDS       T00184                                 

Gene name
metG
Definition
(RefSeq) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00450  Selenocompound metabolism
bat00970  Aminoacyl-tRNA biosynthesis
bat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAS0037 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAS0037 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bat01007]
    BAS0037 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bat03016]
    BAS0037 (metG)
Enzymes [BR:bat01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BAS0037 (metG)
Amino acid related enzymes [BR:bat01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAS0037 (metG)
Transfer RNA biogenesis [BR:bat03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAS0037 (metG)
 Prokaryotic type
   Other AARSs
    BAS0037 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 2848894
NCBI-ProteinID: YP_026324
UniProt: Q81W03
Position
41599..43581
Genome map
AA seq 660 aa AA seqDB search
MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKCMQGYNVHYLTGTDEHGQKIQ
KKAEELNVTPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHKDVVEKIFKQLVDQGDI
YLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHDVELVREESYFFRMGKYV
DRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSFDWGVRVPGNPKHVIYVWV
DALSNYITALGYGTENEEMYKKFWPADVHLVGKEIVRFHTIYWPIILMALDLPLPKKVFA
HGWILMKDGKMSKSKGNVVDPVILIDRYGLDALRYYLLREVPFGSDGVFTPEGFVERINF
DLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETLVTFAKDTLKKVEEAMENMEFS
VALSSIWQLVSRTNKYIDETQPWVLAKDEDDREKLASVMAHLAEVLRQTGIMLMPFLTVA
PSKMFAQLGLTDEAHTSWGSLSTIGCIPAGTKVEKGQPIFPRLEMDVEVAYIKEQMKASA
PKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEPVKKADKLLKIQLDLGTEKRQVVSG
IAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMILAGEENGVLSLASIDQNIPNGTKIK
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggaaaacaaatccttttatattactaccccaatttattatccaagtggaaaa
ttacacattggacatgcttatacaacagtagcaggagatgcgatggcacgatataagtgc
atgcaaggatataatgttcattatttaacaggaactgatgagcatggacagaagatccaa
aagaaagcagaagaattaaacgttacaccacaagcatatgtggataacatcgttgcagga
attaaagaactttgggaaaagatggatatctcttatgatgattttattcgtacaacggaa
gatcgtcataaagatgttgttgaaaaaatcttcaagcaactagtagatcaaggtgatatt
tatcttgatgaatatgaaggttggtattctgtacaagatgagacattctatacggagcat
caattagtagatccaattatggaaggtgacaaagtagttggaggaaaaagtccagatagt
ggtcatgatgtagaacttgttcgtgaagaatcgtatttctttagaatgggtaaatatgtc
gacagactattaaaattctatgaagataatccacatttcattcagccagagtctcgtaag
aatgaaatgattaataacttcattaaaccaggcttagaagatttagcagtttctcgtact
tcatttgactggggagttcgtgttccaggtaatccgaaacacgttatttacgtatgggtt
gacgcactatctaactacattacagcattaggctatggaacagaaaatgaagagatgtat
aagaagttctggccggcagatgtgcatttagttggaaaagaaatcgttcgtttccataca
atttattggccaatcattttaatggcattagatttacctcttccgaaaaaagtctttgct
cacggttggattttaatgaaggatggaaagatgagtaagtcaaaaggaaatgtagtagat
ccagttatattaatcgatcgttacggattagatgcattacgttattacttacttcgtgaa
gttccattcggatctgatggcgtattcacaccagaaggatttgtggagcgtattaatttc
gatttagcaaatgacttaggtaacttattaaatcgtacagtagctatgattgataagtac
tttaacggagaaatccctgcatttaaagcaaatgtaacggaatttgatgaaacgttagta
acatttgcgaaagatacattgaaaaaagttgaagaagcaatggagaatatggaattctct
gtagctctaagctcaatttggcaattggttagccgtacgaataaatatattgatgaaaca
caaccatgggtattagcgaaagatgaggatgatcgtgaaaagttggcgtctgtaatggct
catttagcagaagtacttcgtcaaacgggtattatgcttatgccattcttaacagtagca
ccaagcaaaatgtttgctcagcttggccttactgatgaagcacatacatcttggggaagc
ctatctacaatcggctgtattccagctggaacaaaagtagaaaaaggacaaccaattttc
cctcgtttagaaatggacgtggaagtggcgtacattaaagaacaaatgaaagcctctgct
cctaaagtagaagagaaaaaagaagaagaaccgaaggcagaagaaattacaattgatgat
ttctttaaagtagaattgcgtgtagctgaagtactatctgctgaacctgtaaaaaaggca
gataagttgttgaaaattcaactagacttaggtacagaaaagcgtcaagttgtttctgga
attgcaaaattctattcgccagaagacctaaaaggtaaaaaggttatttgtgtaacaaat
ttaaaacctgtaaaattacgcggtgaattatcgcaaggtatgattttagcgggtgaagag
aatggtgtattgtcattagcatctattgaccaaaatataccaaatggtacaaaaatcaag
taa

DBGET integrated database retrieval system