KEGG   Bacillus anthracis Sterne: BAS0155Help
Entry
BAS0155           CDS       T00184                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00220  Arginine biosynthesis
bat00330  Arginine and proline metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01130  Biosynthesis of antibiotics
bat01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BAS0155
   00330 Arginine and proline metabolism
    BAS0155
Enzymes [BR:bat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BAS0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 2851626
NCBI-ProteinID: YP_026440
Position
152604..153497
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcggttattggagttccaatggatttagggcagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtagatcatattatagaagaagggcgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgtggcgaaacattataaaaacctaggtgttatttggtac
gatgcacatggtgatttaaatacagaagaaacttcaccatctgggaatattcacggtatg
tcacttgcagcaagtttagggtatggacatcccacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtcattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattcacaatgcacgagattgatcgtatg
ggtatgacagctgttatggaagaaacaattgaatatttatctcatactgacggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcctatcttatcgtgagagccatttagcaatggagatgttagcggaagctgat
attgttacatctgcggagtttgttgaggtaaatatgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system