KEGG   Bacillus anthracis Sterne: BAS1337Help
Entry
BAS1337           CDS       T00184                                 

Definition
(RefSeq) precorrin-2 dehydrogenase
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00860  Porphyrin and chlorophyll metabolism
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAS1337
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     BAS1337
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     BAS1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M YtxH Shikimate_DH Pyr_redox_2 CoA_binding_2 DUF711
Motif
Other DBs
NCBI-GeneID: 2850685
NCBI-ProteinID: YP_027606
Position
1369041..1369658
Genome map
AA seq 205 aa AA seqDB search
MYPLTVRVEKKRVVVIGGGKVAGFKIIPLLKQGADIVVVSPELDANLVKLVEEKKIRWYQ
REYEKSDINGAFLVVAASSDAVLNEKVAEDTAENQLVNVITNPESGNVHFPAAFHRGLLN
IAVSTGGASPKLAKKIRDDIANKYDEAYESYLDFLYEVRIKVKELQIEKRERNILLQEVL
KSIYVQNEQKRELFLQELERRVHIG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtatccacttacagtgcgagttgagaagaaacgtgttgttgtcattggtggagggaaa
gttgcgggatttaaaattattcctttgctaaaacaaggtgcagatatagttgtggtaagt
cctgaattggatgcgaatttagtgaaacttgtagaagaaaagaaaattcgttggtatcaa
agagaatatgaaaaaagtgatattaatggtgcttttttagttgtagccgcgagtagtgat
gccgtattgaacgaaaaggttgctgaagatacggcagaaaatcagctggtaaatgttatt
acgaatccggaaagtggaaatgttcattttccggcggcgtttcatcgtgggctacttaat
atagctgtttctaccgggggagcgagtccgaaacttgcaaaaaaaattcgagatgatatc
gcaaataaatatgatgaggcgtatgaatcatatcttgattttttatacgaagttagaata
aaggtgaaagaattacaaatagagaaaagagagagaaatatattgttgcaagaggtattg
aagtcaatatatgttcaaaatgaacaaaaaagagaattgtttttacaagaattagagaga
agagttcatataggatga

DBGET integrated database retrieval system