KEGG   Bacillus anthracis Sterne: BAS2602Help
Entry
BAS2602           CDS       T00184                                 

Definition
(RefSeq) ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00030  Pentose phosphate pathway
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
bat01230  Biosynthesis of amino acids
Module
bat_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bat_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAS2602
Enzymes [BR:bat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     BAS2602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-GeneID: 2850128
NCBI-ProteinID: YP_028861
UniProt: Q81PL1
Position
2594042..2594704
Genome map
AA seq 220 aa AA seqDB search
MDLKQIAGEYAATFVKDGMKIGLGTGSTAYWTIQKLGQRVKEGLSIQAVPTSKETEALAQ
QLNIPLISLNDVQSLDLTIDGADEIDSNLQLIKGGGGALLREKIVASSSKELIIIVDESK
VVTRLGTFPLPIEIIPFAWKQTESKIQSLGCQTTLRLKNNETFITDNNNMIIDCIFPNHI
PTPSDLHKRLKMITGVVETGLFVNMTSKAIIGTKNGIQEL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaacagatagctggtgaatatgctgcaaccttcgtaaaagatggtatgaag
attggtcttggtacaggatcaaccgcatactggacgatacaaaaattaggtcaacgtgta
aaagagggattatcaattcaagctgtcccgacatcaaaggaaacggaagcattggcacag
cagctaaatattccgttgatttcgttaaacgacgtacaaagtcttgatcttacaattgat
ggagctgatgaaattgattctaatttacagcttattaaaggaggtggtggtgcattactt
cgcgagaaaattgtagcctcctcctcgaaagaacttatcattatcgttgatgaatcaaaa
gttgtgacgcgtttagggacttttccattacctattgaaatcataccttttgcatggaaa
caaaccgaaagtaaaattcaatctttaggatgtcaaacaacgttacgcttaaaaaataat
gaaacgtttatcaccgataataataacatgattatcgattgtatattccctaatcatata
cctactccttccgatttacacaaaagattaaaaatgattactggtgtagttgaaaccgga
ttgtttgttaatatgactagtaaggcgattattggaacaaaaaacgggatacaggaatta
taa

DBGET integrated database retrieval system