KEGG   Bacillus anthracis Sterne: BAS3145Help
Entry
BAS3145           CDS       T00184                                 

Definition
(RefSeq) HAD hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00361  Chlorocyclohexane and chlorobenzene degradation
bat00625  Chloroalkane and chloroalkene degradation
bat01100  Metabolic pathways
bat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAS3145
   00361 Chlorocyclohexane and chlorobenzene degradation
    BAS3145
Enzymes [BR:bat01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BAS3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD PGP_phosphatase
Motif
Other DBs
NCBI-GeneID: 2853044
NCBI-ProteinID: YP_029402
Position
complement(3120371..3121081)
Genome map
AA seq 236 aa AA seqDB search
MKYKVILFDVDDTLLDFPETEKHALHNAFVQFGMPTGYTDYLASYKEISNGLWRDLENKM
ITLSELAVDRFRQLFALHNIEVDAQQFSDVYLKNLGKEVHLIEGAVQLCEKLQDCKLGII
TNGYTKVQQSRIGNSPLRNFFEHIIISEEVGHQKPAREIFDYAFEKFGITDKSSVLMVGD
SLTSDMRGGEDYGIDTCWYNPSLKENKASVKPTYEVESLLQILELVEVAEEKVVSF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaagttatattattcgacgtagacgatacattattagatttccctgaaacg
gaaaaacacgcattacataatgcgtttgtacagttcggtatgcctacagggtatactgat
tatcttgcaagttataaagagattagtaatgggttatggagagatttagaaaataaaatg
attacgctaagtgaattagcggtagatcgatttagacaattgtttgcactgcataatata
gaagtagatgcgcagcaatttagtgatgtatatcttaaaaacttagggaaagaagtacat
cttatagaaggtgcagtgcaattatgtgagaagctacaagattgcaagctaggtatcatt
acgaatggatatacgaaggtgcaacaatctagaattggaaattcgcctttacgtaatttc
tttgaacatattattatttctgaagaggttggccatcaaaaaccagcacgtgagattttt
gattatgcgtttgaaaagtttggaattacggataaatcaagtgtactaatggttggagat
tcgctcacttctgatatgagaggcggagaagattacggcattgatacgtgttggtataat
ccgagtttgaaagagaataaggcaagtgttaagccgacttatgaagtggagagtctgctg
caaattttagaacttgtagaagtggcggaagaaaaggtagtatcattttaa

DBGET integrated database retrieval system