KEGG   Bacillus anthracis Sterne: BAS3160Help
Entry
BAS3160           CDS       T00184                                 

Definition
(RefSeq) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00900  Terpenoid backbone biosynthesis
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01130  Biosynthesis of antibiotics
Module
bat_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAS3160
Enzymes [BR:bat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BAS3160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 2849772
NCBI-ProteinID: YP_029417
UniProt: Q81N10
Position
3134329..3135486
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATK
ELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHK
ESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGITPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccatcggcacatcggcattagat
gtcgtttcagctcatcccgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gagcttcttgaacaacaaatcaaaacgtttcaacctcgcattgtaagcgtcgcgacaaaa
gaattagcagacacgcttcgtacgcgtatttcaaccaacacaaaaatcacatacggaaca
gatggcttaattgcagtagctactcaccctaattcaaatcttgtattaagttccgtcgtt
ggtgtttcaggattactcccaacaattgaagcattaaaagcgaagaaagatattgccatc
gctaataaagaaacgttagttgcagctggtcatattgtaactgaactggccaaacaaaac
ggatgtcgtttaattccagtcgatagcgaacattcagctattttccaatgtttaaacgga
gaaaataataaagaaattgacaaattaatcgttacagcttctggcggtgcattccgtgat
aaaacacgtgaagaaatgaaaactctacaagcaaaagatgctttaaagcacccaaactgg
ttaatgggggcaaaactaacgattgattctgccacgttaatgaataaaggatttgaagta
atggaagcgagatggttatttgatattccttatgaaaaaattaatgtaatgattcataaa
gaaagcattattcattctttagtagagtttatcgatggatcagttatagcacagctcggt
gctcctgatatgaggatgccgattcaatatgcgtttcactaccctactcggctgccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagtttccttgtctacaatacgcatatgaatgtggcaaaattggtggtattactcct
gctgtattaaacgcagcaaatgaaattgcgaatgcactattcttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagcccatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcaaatcaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system