KEGG   Bacillus anthracis Sterne: BAS3932Help
Entry
BAS3932           CDS       T00184                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00071  Fatty acid degradation
bat00072  Synthesis and degradation of ketone bodies
bat00280  Valine, leucine and isoleucine degradation
bat00310  Lysine degradation
bat00362  Benzoate degradation
bat00380  Tryptophan metabolism
bat00620  Pyruvate metabolism
bat00630  Glyoxylate and dicarboxylate metabolism
bat00640  Propanoate metabolism
bat00650  Butanoate metabolism
bat00900  Terpenoid backbone biosynthesis
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01200  Carbon metabolism
bat01212  Fatty acid metabolism
bat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAS3932
   00630 Glyoxylate and dicarboxylate metabolism
    BAS3932
   00640 Propanoate metabolism
    BAS3932
   00650 Butanoate metabolism
    BAS3932
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAS3932
   00072 Synthesis and degradation of ketone bodies
    BAS3932
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAS3932
   00310 Lysine degradation
    BAS3932
   00380 Tryptophan metabolism
    BAS3932
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAS3932
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAS3932
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAS3932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bat04147]
    BAS3932
Enzymes [BR:bat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAS3932
Exosome [BR:bat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAS3932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 2848084
NCBI-ProteinID: YP_030182
Structure
PDB: 

Position
complement(3881767..3882942)
Genome map
AA seq 391 aa AA seqDB search
MHNVVITAAVRSPIGTFGGALKNVTPVELAVPVLQEAVKRGGVEPHEVDEVILGHCIQRT
DEANTARTAALAAGFPDTVTGYTIQRQCSSGMQAIMSAAMQIQLGVSEVVVAGGVEAMSS
SPYALKQHRWGQRLQHGEIRDTVWEVLEDPIHHIMMGETAENLVEQYEITREEQDEVALR
SHTLALKAIESGYFDDQIVPITIKERRKEVVFSKDEHPRADITAEKLAGLKPAFRKDGSV
TAGNASGLNDGSAVLVLMSEEKAKEKGLQPLARIVGYSVAGVDPKIMGIGPAPAIRKGLE
KVDWSLEDADLLEINEAFAAQYLAVEKELGLDREKVNVNGSGVGLGHPIGCTGARITVSL
IHELKRRGLEKGIASLCVGGGIGVALFIEAL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgttgttattacagctgcagttcgttcgccaattggaacttttgggggagcg
ctaaaaaatgtaacgccagtagaattagctgttcctgtacttcaggaagctgtaaaacga
ggcggggtagaaccacacgaagtggatgaagtgattttaggtcattgtattcaaagaact
gatgaagcaaatacggcgagaacggctgcattagcggcaggatttcctgacacagttacg
ggctatacaatccaacgccaatgttcttcaggtatgcaagcaattatgtcggctgcaatg
caaattcaattaggtgtaagtgaagttgttgttgcaggtggagtagaagcaatgagttca
agcccctatgcattgaaacaacaccgctggggacaacgcctacaacacggagaaattcgt
gatacggtgtgggaagtgttagaagatccgattcatcatattatgatgggggaaacagcg
gaaaatttagttgaacaatatgaaattacaagagaggaacaagatgaagttgcgcttcgc
agtcatacattggcactgaaggcaatcgagtctggatactttgacgatcaaattgttcct
attacaataaaagaacgtagaaaagaagtagtattttcgaaggatgaacatccacgtgct
gatattacagcagaaaaattagctgggttaaaaccagctttccgtaaagatggatctgta
acggcagggaatgcatctggcctgaatgacggaagcgcggttctagtattaatgagcgaa
gaaaaagcgaaagaaaaaggcttacaaccgttagctagaattgttggatattcagtagct
ggagtagatccaaaaattatggggattggaccagcaccagcaattcgtaaaggattagaa
aaagtagattggtcattagaagatgcagatttactggaaattaatgaagctttcgctgca
caatacttagctgtagagaaagaattaggtttagatcgtgaaaaagtgaatgtaaatggt
agtggtgtaggacttggacatccaattggttgtacaggagctcgtattactgtaagttta
attcatgaattaaaaagacgcgggttagaaaaaggaattgcctctctatgcgtcggcggc
ggtattggagtagcattatttatagaagcactataa

DBGET integrated database retrieval system