KEGG   Bacillus anthracis Sterne: BAS3947
Entry
BAS3947           CDS       T00184                                 

Definition
(GenBank) hydrolase, haloacid dehalogenase-like family
  KO
K08966  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase [EC:3.1.3.87]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00270  Cysteine and methionine metabolism
bat01100  Metabolic pathways
Module
bat_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BAS3947
Enzymes [BR:bat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.87  2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase
     BAS3947
SSDB
Motif
Pfam: HAD Put_Phosphatase UMPH-1 Hydrolase HAD_2
Other DBs
NCBI-ProteinID: AAT56248
UniProt: Q81MJ1
Position
3894844..3895503
AA seq 219 aa
MSIQVFCDFDGTITNNDNIMSIMEKFAPPEAEEVKNRILSQELSIQEGVSQLFQLIPTNL
HDEIIQFLIETAEIRNGFHEFIQFVNENNISFYVISGGMDFFVYPLLQGLIPKEQIYCNE
TDFSNEYITVNWPHPCDRLCQNHCGLCKSSLIRKLSDTNDFHIVIGDSITDLQAAKQADK
VFARDFLITKCEENHISYTPFETFHDVKTELKHLLEVKL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagtattcaagtattttgtgatttcgatggcacgattacaaataatgataacattatg
tccattatggagaaattcgcaccaccagaagctgaagaagtaaagaatagaattttatca
caagagctatctattcaagaaggtgtttctcaattatttcaattaatacctactaatctg
cacgatgaaattattcaatttttaatagagactgctgaaattcgtaatggttttcatgaa
tttatacaatttgtaaatgaaaacaatatttccttttatgttatatcaggtggaatggat
ttcttcgtctatccactcttacaaggactcattccaaaagagcaaatttactgtaatgaa
acagatttttcaaatgaatacattacggtgaattggcctcatccttgtgatcgtctttgt
caaaatcattgcggattatgtaaatcatcactcatccgtaaattgagtgatacgaatgac
ttccatattgtaattggagattcaattaccgatttacaagctgcaaaacaagcggataaa
gtgttcgctcgtgatttccttattacaaaatgcgaagaaaatcatatttcttatacacca
tttgaaacgtttcacgatgttaaaactgaattaaaacatttgttggaggtgaaattatga

DBGET integrated database retrieval system