KEGG   Bacillus anthracis Sterne: BAS4789Help
Entry
BAS4789           CDS       T00184                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00040  Pentose and glucuronate interconversions
bat00052  Galactose metabolism
bat00500  Starch and sucrose metabolism
bat00520  Amino sugar and nucleotide sugar metabolism
bat01100  Metabolic pathways
bat01130  Biosynthesis of antibiotics
Module
bat_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAS4789
   00052 Galactose metabolism
    BAS4789
   00500 Starch and sucrose metabolism
    BAS4789
   00520 Amino sugar and nucleotide sugar metabolism
    BAS4789
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAS4789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 2849844
NCBI-ProteinID: YP_031032
Position
complement(4678388..4679275)
Genome map
AA seq 295 aa AA seqDB search
MKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGKT
KRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARKF
IGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQEG
RRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNEI
QRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgttttttacca
gctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaatac
attgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaaacg
aagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttattagaa
aagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacattcac
tatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaattc
atcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaacca
tgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgtacaa
acggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaagga
cgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttcaaac
ttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaacaa
catgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaaatt
caacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagctagga
ttcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatggtt
acgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system