KEGG   Bacillus anthracis Sterne: BAS4806Help
Entry
BAS4806           CDS       T00184                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00300  Lysine biosynthesis
bat01100  Metabolic pathways
bat01110  Biosynthesis of secondary metabolites
bat01120  Microbial metabolism in diverse environments
bat01130  Biosynthesis of antibiotics
bat01230  Biosynthesis of amino acids
Module
bat_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BAS4806 (dapF)
Enzymes [BR:bat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BAS4806 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-GeneID: 2848459
NCBI-ProteinID: YP_031049
UniProt: Q81XR2
Structure
PDB: 

Position
complement(4699728..4700594)
Genome map
AA seq 288 aa AA seqDB search
MSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAP
VKMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFTIETLAGIVTAEVTVEEGKVTL
AKIDMGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAP
LTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILN
GKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYKIEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattttcttttacaaaaatgcatggtcttggcaatagttatatatatgtaaat
atgtttgaagaacaaattcctgaagaagatttagctcttgtggcggaaaaggtttcaaat
attaatactggtattggagccgatggaatgattttaatttgtccatctgacgtagcacct
gtgaaaatgcgcatgtttaataatgatggatcagaaggaaagagctgtggtaacggtcta
cgctgcgtagcgaaatatgcgtatgagcataaactagtagaagatacagttttcacaatt
gaaacgttagctggcattgtaacggcggaagtaacggtagaagaagggaaagttacgtta
gcgaaaatcgatatgggagcacctcgtttaacacgtgcagaaataccgatgcttggtgaa
ggtgaaacaccatttattcgtgaaaacttcttatacaataatcatcgttatgcatttaca
gctgtttcaatgggaaatccgcatgcggttatttttgtggatgatgtagaacaagcacct
cttacaacacttggaccagttcttgagacacatgaaatgttcccagaacgagtaaatgtt
gaattcattgagattttgaatgaggaagagatgaacttccgcgtttgggaacgtggatct
ggcgtaacacaagcttgcggaacaggggcgtgtgctgcagttgtagcctctattttaaat
ggaaagatggaacgtggtaaggaaattacagttcatttagctggtggcgatttaatgatt
gcatggacagaagaaggcaacgtgttaatgaaaggaccagcagaagtaatttgccgcgga
gtgtatgagtacaagatagaagcgtaa

DBGET integrated database retrieval system