KEGG   Bacillus anthracis Sterne: BAS4827Help
Entry
BAS4827           CDS       T00184                                 

Definition
(RefSeq) hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00627  Aminobenzoate degradation
bat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAS4827
Enzymes [BR:bat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BAS4827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 Isochorismatase DUF4332
Motif
Other DBs
NCBI-GeneID: 2849988
NCBI-ProteinID: YP_031070
Position
complement(4716552..4717316)
Genome map
AA seq 254 aa AA seqDB search
MYKGYLIDLDGTMYRGEEQIEEASDFVKALGERGIPYLFVTNNSTRKPEQVAEKLVRFDI
PAKAEQVFTTSMATANFIYERKQDATVYMIGEEGLHDALVEKGFELVDENPDFVVVGLDR
DITYEKLAKACLAVRNGATFISTNGDIAIPTERGLLPGNGSLTSVVAVSTGVDPIFIGKP
ESIIMEQALKVLGIEKNEALIVGDNYDTDILAGINAGMHTLLVHTGVTTVEKLTEYEVQP
TQVVHNLTEWIEKM
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggttacttaattgacttagacggtacaatgtatcgcggagaagaacaaatt
gaagaagcgagcgactttgtaaaagcattaggagagcgcggcattccatatttattcgtt
acgaataactcaactcgtaaaccagaacaggtagcagaaaaacttgttcgtttcgatatt
ccagcgaaagcagagcaagtattcacaacgagtatggcaacagcaaactttatttatgaa
cgtaaacaagacgcaactgtatatatgattggtgaagaaggcttacatgatgcacttgtg
gaaaaaggatttgaacttgtggatgaaaatcctgatttcgttgttgtcggtttagatcgt
gacatcacatatgaaaaattagcaaaagcttgtcttgctgtgcgtaacggcgcaacgttt
atttctacaaatggagacattgccattccgactgagcgcggattattaccaggtaacggt
tcattaacatcagttgtagcagtatcaacaggcgtggatccaatctttatcggaaaacca
gaatcaatcattatggaacaagctttaaaagtgcttggcatagaaaagaatgaagcctta
atagttggggataactacgatacagacattttagcaggaataaatgccggtatgcatacg
cttcttgtccacactggagtcacaactgtggagaagttaacagaatacgaagttcaaccg
acgcaagttgtacataacttgacggagtggattgagaagatgtaa

DBGET integrated database retrieval system