KEGG   Bacillus anthracis Sterne: BAS5179Help
Entry
BAS5179           CDS       T00184                                 

Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00240  Pyrimidine metabolism
bat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BAS5179
Enzymes [BR:bat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BAS5179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_14 UvrD-helicase zf-C4_ClpX
Motif
Other DBs
NCBI-GeneID: 2851937
NCBI-ProteinID: YP_031418
UniProt: Q81JX0
Structure
PDB: 

Position
complement(5059109..5059693)
Genome map
AA seq 194 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFKHITEEMDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSACGSPASRTQRLIDGEPAAFDDPIILVGASESYE
PRCRHCHAVPTKQR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcagaacggttggattgaagtgatttgcggtagtatgttttctggt
aaatcagaagagcttatccgccgtgttcgtcgtacgcaatttgcgaaacaacatgcaatt
gtatttaaaccatgtattgataatcgctatagtgaagaagacgttgtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaagatatatttaaacatatcactgaa
gaaatggatgtaattgcaattgatgaagtgcaattctttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtaacaaaa
ctacaagctgtatgttctgcatgtggatctccggcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccaattattttagttggtgcttcagagtcgtatgaa
ccacgctgtcgtcattgtcatgcagttcctacaaaacaaagataa

DBGET integrated database retrieval system