KEGG   Bacillus anthracis Sterne: BAS5218Help
Entry
BAS5218           CDS       T00184                                 

Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bat  Bacillus anthracis Sterne
Pathway
bat00330  Arginine and proline metabolism
bat01100  Metabolic pathways
Module
bat_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BAS5218
Enzymes [BR:bat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BAS5218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-GeneID: 2848265
NCBI-ProteinID: YP_031457
UniProt: Q81JT1
Position
complement(5106377..5107249)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcagaggtagttatttacgggatgcctatggattggacagtaagttaccgtccagga
tctcgctttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
tttggaaatgcacaacgcagcttagacatgattgaagaatatgtatcaaaacttttagat
gccggtaagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccatatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacacctattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatacaaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgagggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagctcctgtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtaaagtaa

DBGET integrated database retrieval system