KEGG   Bacillus atrophaeus NRS 1221A: TD68_09485Help
Entry
TD68_09485        CDS       T03711                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
batr  Bacillus atrophaeus NRS 1221A
Pathway
batr00071  Fatty acid degradation
batr00072  Synthesis and degradation of ketone bodies
batr00280  Valine, leucine and isoleucine degradation
batr00310  Lysine degradation
batr00362  Benzoate degradation
batr00380  Tryptophan metabolism
batr00620  Pyruvate metabolism
batr00630  Glyoxylate and dicarboxylate metabolism
batr00640  Propanoate metabolism
batr00650  Butanoate metabolism
batr00900  Terpenoid backbone biosynthesis
batr01100  Metabolic pathways
batr01110  Biosynthesis of secondary metabolites
batr01120  Microbial metabolism in diverse environments
batr01130  Biosynthesis of antibiotics
batr01200  Carbon metabolism
batr01212  Fatty acid metabolism
batr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:batr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TD68_09485
   00630 Glyoxylate and dicarboxylate metabolism
    TD68_09485
   00640 Propanoate metabolism
    TD68_09485
   00650 Butanoate metabolism
    TD68_09485
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TD68_09485
   00072 Synthesis and degradation of ketone bodies
    TD68_09485
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TD68_09485
   00310 Lysine degradation
    TD68_09485
   00380 Tryptophan metabolism
    TD68_09485
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TD68_09485
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TD68_09485
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TD68_09485
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:batr04147]
    TD68_09485
Enzymes [BR:batr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TD68_09485
Exosome [BR:batr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TD68_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJF85651
Position
complement(1958014..1959195)
Genome map
AA seq 393 aa AA seqDB search
MTKTVIVSAARTPFGKFGGALKELKAAELGGIAIKEALNRAGINGSQADEVIMGMVVQAG
AGQIPSRQAARLAEVPWEVPTETINKVCASGLRAVTLGDQIIRAQDGDILVAGGMESMSN
IPYAVPAGRWGARMGDAAMQDLMVYDGLTCAFDQVHMAVHGNTAAEEYGITRKEQDEWAL
RSQKRAAHAIDEGKFKEEIVPVAWVDRKGKTKTADTDEGLRRETSLEQLAKLPPIYSKEG
SVTAGNAPGVNDGAGAFVLMSEEKAAELGKKPLATILGFAAVGQEASCLAAAPGLAINKL
LKKTGFSVQDIDLFEVNEAFASVALTCEKIVGWDREKVNVNGGAIALGHPIGASGARILM
TLIYELKRRGGGLGIAAICSGAAQGDAILIRVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacagtcatcgtgagtgccgcaagaacaccttttggcaaatttggcggagct
ttaaaggagctgaaggctgctgaactcggggggattgccattaaggaagctttgaaccgg
gcgggaatcaatgggagccaagcagacgaagtcattatgggcatggtcgttcaagcaggc
gcaggccaaatcccgtctcgccaggctgcccgtttggcggaggtgccgtgggaggtgccg
actgaaacgattaataaagtatgcgcatcaggtcttcgggcggtcaccttgggggatcaa
atcatcagggctcaagatggggatatccttgtagctggaggaatggaaagcatgagtaat
attccttatgccgttccggcgggacgctggggcgcccgtatgggggatgctgcaatgcag
gatctgatggtttatgacggattaacctgtgcttttgatcaggttcacatggctgttcat
gggaatactgcggctgaagaatatggaattacccgtaaggagcaggatgagtgggctctg
cgcagccagaaaagggctgctcatgcgattgatgaagggaagtttaaagaggaaattgtg
ccggttgcttgggttgaccgaaaagggaagacgaaaacagcggataccgatgaaggtctg
cgccgggagaccagtttagagcagcttgcaaaactgccgccgatttattcgaaggaggga
tcggtcactgccggcaatgcaccgggagtaaatgacggagcgggagcttttgtgctcatg
tcagaagaaaaagccgccgagctcggaaagaaaccgctggcgacgatactcggattcgca
gcagtcggccaggaagcatcatgtcttgctgcggccccggggcttgccatcaataaactg
ctgaaaaaaaccggtttttcggttcaggatatcgacttgtttgaagttaatgaagcattt
gcttctgttgcgttgacatgcgaaaaaatcgtcggatgggaccgtgaaaaggtaaacgtg
aatggcggggccattgctcttggacacccgattggagcaagcggcgcaagaatacttatg
actttgatatacgaattgaagcgaaggggaggcggtttaggtatcgctgccatctgcagc
ggggccgcccaaggtgacgccatattaatccgggtccattga

DBGET integrated database retrieval system