KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_299Help
Entry
BUAPTUC7_299      CDS       T00821                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
bau00010  Glycolysis / Gluconeogenesis
bau00260  Glycine, serine and threonine metabolism
bau00680  Methane metabolism
bau01100  Metabolic pathways
bau01110  Biosynthesis of secondary metabolites
bau01120  Microbial metabolism in diverse environments
bau01130  Biosynthesis of antibiotics
bau01200  Carbon metabolism
bau01230  Biosynthesis of amino acids
Module
bau_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAPTUC7_299 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BUAPTUC7_299 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BUAPTUC7_299 (gpmA)
Enzymes [BR:bau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BUAPTUC7_299 (gpmA)
Membrane trafficking [BR:bau04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BUAPTUC7_299 (gpmA)
Exosome [BR:bau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BUAPTUC7_299 (gpmA)
  Exosomal proteins of melanoma cells
   BUAPTUC7_299 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ACL30112
UniProt: B8D7J7
Position
338685..339380
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIIYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgccgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattatttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttagatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system