KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_411Help
Entry
BUAPTUC7_411      CDS       T00821                                 

Gene name
eno
Definition
(GenBank) enolase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Pathway
bau00010  Glycolysis / Gluconeogenesis
bau00680  Methane metabolism
bau01100  Metabolic pathways
bau01110  Biosynthesis of secondary metabolites
bau01120  Microbial metabolism in diverse environments
bau01130  Biosynthesis of antibiotics
bau01200  Carbon metabolism
bau01230  Biosynthesis of amino acids
bau03018  RNA degradation
Module
bau_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BUAPTUC7_411 (eno)
  Energy metabolism
   00680 Methane metabolism
    BUAPTUC7_411 (eno)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BUAPTUC7_411 (eno)
Enzymes [BR:bau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     BUAPTUC7_411 (eno)
Messenger RNA biogenesis [BR:bau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BUAPTUC7_411 (eno)
Exosome [BR:bau04147]
 Exosomal proteins
  Proteins found in most exosomes
   BUAPTUC7_411 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACL30212
UniProt: B8D7U7
Position
454273..455577
Genome map
AA seq 434 aa AA seqDB search
MSKITKIIAREIIDSRGNPTVESEVHLEGGFVGLASSPSGASTGSLEALELRDENKDRFM
GKGVEKAVSLINEKISIALKNKNARNQSDIDHIMIDLDGTINKSKLGANAILSVSLAVAK
AAAASKRMPLYAHIAEINETPGVFSMPLPMINIINGGKHANNNIDIQEFMIQPISAKTVK
ESIRIGCEIFHALGELLKEKGMSTTVGDEGGYAPNLKSNEEALNIIQDAIQKTKYKLGQD
IRLAIDCAASELYNKNEKKYNLKGENISFSSKEFTHYLEKLSQKYPIVSIEDGQDESDWE
GFLYQTHVLGHKIQLVGDDLFVTNKNILKKGIKKGIANSILIKLNQIGTLTETLEAIKTA
KQANYGVIISHRSGETEDASIADLSVGTSSGQIKTGSMSRSDRTSKYNQLIRIEENLGTK
YAPFHGLREIKSAF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattacaaaaatcatagctcgtgaaattatagattcacgaggcaatcctact
gttgaatctgaagttcatttagaaggtggatttgtcggactagcttcttctccttccgga
gcctctaccggttctttagaagctttagaattaagggatgaaaataaagacagattcatg
gggaaaggagtggaaaaagctgtttcgttaataaacgaaaaaatatctattgcattaaaa
aataaaaatgctagaaatcaaagtgatattgatcatattatgattgatttagacggaaca
atcaataaatccaaactaggtgctaatgcgattttatctgtatctttagctgttgctaaa
gcagctgctgcatctaagagaatgcctttatatgcgcatattgcagaaataaatgagact
cctggcgttttttctatgccattgcctatgataaatattattaatggtggaaaacatgct
aataataatatagatattcaggagtttatgattcaaccaatcagcgcaaaaacagtaaaa
gaatctatacgtataggatgtgaaatatttcatgcattaggtgaattattaaaagaaaaa
ggaatgagtacaactgtaggagatgaaggaggttatgcaccaaacttgaagtctaatgaa
gaagcattaaatattattcaagatgcaatacaaaaaactaaatataaattaggacaagat
atacgattagcaatagattgtgctgcttcagaattatataataaaaacgaaaaaaaatat
aatcttaaaggagaaaatattagtttttcttcaaaggaattcactcattatttagaaaaa
ttatctcaaaaatatccgatagtttcaatcgaagatggacaagatgagtcagattgggaa
ggatttttatatcaaacacatgtactaggtcataaaatacagttagtaggagatgattta
tttgttacaaataaaaatattttaaaaaaaggtataaaaaaaggaattgcaaattcaata
ttaataaagttaaatcaaattggaacattaactgaaactctagaagcaataaaaacagca
aaacaagcaaactatggagtaattatttctcatcgttcaggtgaaacagaagacgcttct
atagcagatttatctgtaggaacatcatcaggacaaattaaaacaggttctatgagtcgt
tctgatagaacttcaaagtataatcaattgattagaattgaagaaaatttaggaacaaaa
tacgctccgtttcatggtttacgagaaattaaatcagcattttaa

DBGET integrated database retrieval system