KEGG   Buchnera aphidicola Tuc7 (Acyrthosiphon pisum): BUAPTUC7_538
Entry
BUAPTUC7_538      CDS       T00821                                 

Gene name
nfuA
Definition
(GenBank) iron-sulfur cluster scaffold protein (YhgI)
  KO
K07400  Fe/S biogenesis protein NfuA
Organism
bau  Buchnera aphidicola Tuc7 (Acyrthosiphon pisum)
Brite
KEGG Orthology (KO) [BR:bau00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BUAPTUC7_538 (nfuA)
SSDB
Motif
Pfam: NifU Fe-S_biosyn adh_short
Other DBs
NCBI-ProteinID: ACL30333
UniProt: B8D868
Position
complement(580901..581479)
AA seq 192 aa
MINISKKAQEHFTSLLSNEPENTQIRVFIVNPGTPNAECGVAFCPENEIELSDIQLKYDG
FFVYVNKDTISYLKNSVIDLVTDKIGSQLTLKAPYAKNNFSKKVSSSLEEKVKCFLNLEI
NPQLSMHGGRVELIKIDKNGIAAIQFSGGCNGCSMIGSTLKETVEKKLLSSFSEIKKVYD
ETHHLHGQHSFY
NT seq 579 nt   +upstreamnt  +downstreamnt
atgattaatatctccaaaaaagcacaagaacattttacatcacttttatcaaatgaaccc
gaaaatactcaaatacgtgtttttatagtcaatccgggtacacctaatgcagaatgcggt
gttgcattttgtccagaaaatgaaatagaactatctgatattcaattaaaatacgatgga
ttttttgtgtacgtaaataaagacacaatttcttatttaaaaaattcagtgatcgatctt
gttactgataaaattggatctcaattaacattaaaagctccatatgctaaaaataatttt
tctaaaaaagtttcatcatcactggaagaaaaagtaaaatgttttttaaatttagaaatc
aatcctcagttatcaatgcacggaggaagagttgaattaattaaaatagataaaaatgga
attgctgcaatacaatttagtggaggctgtaatggctgctcaatgattggatcaacttta
aaagaaacagtcgagaagaaattattatcttctttttctgaaataaaaaaagtttatgat
gagacacatcatctgcacggacaacattcattttattaa

DBGET integrated database retrieval system