KEGG   Bartonella australis: BAnh1_03590Help
Entry
BAnh1_03590       CDS       T02469                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
baus  Bartonella australis
Pathway
baus00740  Riboflavin metabolism
baus00790  Folate biosynthesis
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baus00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BAnh1_03590 (ribA)
   00790 Folate biosynthesis
    BAnh1_03590 (ribA)
Enzymes [BR:baus01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BAnh1_03590 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BAnh1_03590 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AGF74241
UniProt: M1PC94
Position
437190..438302
Genome map
AA seq 370 aa AA seqDB search
MTYNQEKIISAIRAFECGEVVVVTDDDDRENEGDLIVAASHCTEEKMAFIIRHTSGIICA
PMPKEKAQRLNLSPMVSDNNSAHCTQFTVTVDLKRGITTGISAYDRTLTARNLADPNSDA
NDFVRPGHIFPLIASEGGVLTRSGHTEAAVDLCKLAGLPPVGVIGELVNDDGSVKHGDEV
VKFAQDNQLHIVTVADLIAYRQREEILVKRVGEMHIETSAGPAVIWGYQLPWEIVQHAAV
VLGDIYDGKDIPVCLYHENIVGDVFGQSSDVRIIMQRMVEKEKRGVFVYLREGSVNFGSQ
PVVHGREMGMKDAAGHARKIGREKEWHRIGLGAQILKDLGVNSVIIYALKGFHYAGLENF
GIRISRTDIV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgacttataatcaggaaaaaattatttctgccattagggcttttgaatgcggtgaagtc
gttgtggttacggatgatgacgatcgtgaaaatgaaggtgatttaattgttgccgcctct
cattgtacagaagaaaaaatggcatttatcattcgtcatacatcgggcatcatttgtgca
cctatgccgaaggagaaggcgcaacgacttaatctttcgcctatggtctcggataataat
tcagcgcattgtactcaatttactgttaccgttgatcttaaacgtggaataacgaccggt
atttcagcatatgaccgtacattaactgcgcgtaatcttgctgacccaaatagtgatgct
aatgattttgtccgtccagggcacattttccccctgattgcgagtgaaggcggtgttctg
acacgttcgggccacactgaggctgctgttgatttatgcaaattagctggtttaccgcca
gtcggtgtcattggtgagttagttaatgatgatggaagcgtcaagcatggagacgaagtt
gtaaaatttgcacaagataaccaattgcatatcgtaacggttgctgaccttattgcttat
cgtcagcgagaagaaatactggttaaacgtgtcggagagatgcatatagaaacgtctgcg
gggccagctgtgatttggggttatcagctcccttgggaaatagttcagcatgctgcagtc
gttttgggtgatatttacgacggtaaagatatcccagtctgcttgtatcatgaaaatatt
gtgggtgatgttttcggtcaatcatcagacgtaaggattattatgcagcgtatggtagaa
aaagagaaacgtggtgtattcgtttatctacgcgagggatctgttaattttggttctcag
ccggttgttcatggtcgagaaatgggaatgaaggatgcagcaggtcatgcgcggaaaatt
ggacgtgaaaaagaatggcaccgaattggtttaggggcacaaattttgaaagatttaggg
gttaattctgttattatttacgctcttaaaggattccattacgccggcttagaaaatttc
gggattcgaatatcgaggacagatattgtatga

DBGET integrated database retrieval system