KEGG   Bartonella australis: BAnh1_08480Help
Entry
BAnh1_08480       CDS       T02469                                 

Gene name
mraW
Definition
(GenBank) S-adenosyl-methyltransferase
  KO
K03438  16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199]
Organism
baus  Bartonella australis
Brite
Enzymes [BR:baus01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.199  16S rRNA (cytosine1402-N4)-methyltransferase
     BAnh1_08480 (mraW)
Ribosome biogenesis [BR:baus03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    BAnh1_08480 (mraW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_5 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AGF74724
UniProt: M1N492
Position
complement(1065093..1066139)
Genome map
AA seq 348 aa AA seqDB search
MAAIDLEKRKSRWVILVDKSSETRRHVPVLLQPVLAGLAPLVGARVIDGTFGAGGYTRAL
LNAGADVIALDRDPFAIREGQPLVDEFFPRLRLVQTEFSRLDCVVEGKVDAVILDIGVSS
MQLDEAERGFSFQKDGPLDMRMAQTGFTAGDVVNHFKIDDLARMFRKLGEERHAGRIARM
IEKRRRVRPFLRTSDLADAIEILVGRKQGDHIHPATRVFQALRIYVNDELGELARGLFAA
ERVLKAGGRLGVVSFHSLEDRMVKRFFSARSGKGGGSRYLPEIESVPATFVPLFKGGKIA
NEEELRQNPRARSARLRVGVRTEKEAVVADMKLFDLAEIASFEGSKKW
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttggcagctatcgatttggaaaagcgtaaatcaagatgggttattttggtagataaaagt
agtgaaactaggcgtcatgttcctgtgttattgcagccggttttagccgggctcgcacca
ttagttggggcaagggtgattgatggtacctttggtgccggcggttatacgcgtgcctta
ttgaatgcaggcgcagatgtcatcgctcttgatcgcgatccttttgcaattcgcgagggg
cagccactcgtcgatgaatttttcccacgcttgcgtttagtgcaaacggagttttcacga
ttagattgcgtcgttgaagggaaagtagatgcggttattctcgatattggcgtttcttcg
atgcagcttgatgaagctgaacgggggttttcatttcaaaaagatggcccgttggatatg
cgaatggcgcaaactggtttcacagcaggcgacgttgttaatcactttaaaatagatgat
ttggcgcggatgtttagaaaattaggggaagagcgtcacgcgggtcgaattgcgcgaatg
attgaaaaacgtcgccgtgtccgcccttttttgagaacgagcgatcttgctgacgctatt
gagattttagtaggtcgtaagcagggagatcatattcatcctgcgacgcgcgtatttcaa
gcactgcgtatttatgtcaatgatgagcttggtgaacttgcgcgcggcttatttgcggct
gagcgagttttgaaagcaggcggccgtttgggagtagttagtttccattcgcttgaagat
cgtatggtaaaaagatttttttctgcacgttcgggtaaaggaggaggatcacgctatctt
cctgaaatagaatctgttccagcgacatttgtccctttgtttaaaggtggaaaaattgca
aatgaagaagaattgcggcaaaatcctcgtgcacgttctgcaaggctgcgcgttggtgta
cgtaccgaaaaagaggccgtcgtggcggatatgaaattgtttgacttggcagaaattgcc
agttttgaaggcagtaagaaatggtaa

DBGET integrated database retrieval system