KEGG   Bartonella australis: BAnh1_08500Help
Entry
BAnh1_08500       CDS       T02469                                 

Definition
(GenBank) hypothetical protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spo7
Motif
Other DBs
NCBI-ProteinID: AGF74726
UniProt: M1PDQ3
Position
complement(1067949..1068320)
Genome map
AA seq 123 aa AA seqDB search
MKLRWRRTIILILFISLIFVSAFLVYRVFLSYQFVFNGNSLSQQVNLTEDILLERPAVSA
PDAIEKISKMSVQQKRQIIEQARRDAIAAASASGQNNEQAQKFGHVAAEAISKAINHPSA
GAS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttaggtggcgtcgtactattattttaattttgtttatatcgctgatttttgta
tctgcttttttggtttaccgagtttttttatcttatcaatttgtatttaatggtaattct
ctctctcagcaggttaatttgacagaagatatattgttagaaaggccggcagtatctgcg
ccagatgctatagaaaagatatctaagatgagtgttcagcaaaaacggcagattatcgaa
caggcgcgccgggacgcgatcgccgctgcctccgcgagtggccaaaataatgagcaagca
caaaaattcggccacgtcgcggctgaggctatatcgaaagcgataaatcacccttctgct
ggcgcttcttaa

DBGET integrated database retrieval system