KEGG   Bartonella australis: BAnh1_08640Help
Entry
BAnh1_08640       CDS       T02469                                 

Gene name
carA
Definition
(GenBank) carbamoyl-phosphate synthase small subunit
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
baus  Bartonella australis
Pathway
baus00240  Pyrimidine metabolism
baus00250  Alanine, aspartate and glutamate metabolism
baus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baus00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BAnh1_08640 (carA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAnh1_08640 (carA)
Enzymes [BR:baus01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     BAnh1_08640 (carA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase CPSase_sm_chain Peptidase_C26 CbiG_N
Motif
Other DBs
NCBI-ProteinID: AGF74740
UniProt: M1P4F7
Position
1090905..1092101
Genome map
AA seq 398 aa AA seqDB search
MTQTISSPSPWSVSKPTALLILADGTIIEGKGAGATGVAEAELCFNTAITGYEEILTDPS
YTGQIVNFTFPHIGNVGTNNEDIEDLTPLNDRGAIGAIFKADITHPSSYRAIENFNQWLK
THQIIALCGIDTRALTVLIREKGAQNAVIAHDLNGNFDINALKERAQKWHGLINLDLAKK
VTSKKLVNWNEKPWVWNESYSENNKKNFHIVAIDYGIKRNILRLIAAQGAHITVVPAHMN
AEEILAMNPDGIFLSNGPGDPAATAEYAVPTIKTLIDCNIPLFGICLGHQLLALAVGAKT
VKMHQGHHGANHPVKDLTTGKVEIASMNHGFAVDASSLPQHVEETHISLFDGSNCGLKIS
GKPIFSVQHHPEASPGPQDSHYLFTRFRDLVVNYKKTI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaccatctcttcccccagtccttggagcgtgagcaagcctacagccctttta
atattggctgatgggacaattattgaaggtaaaggcgcaggcgccacaggtgttgcagaa
gctgaattatgttttaacaccgccatcactggctatgaagaaatccttacagacccgtca
tacactggacaaatcgttaatttcacctttcctcatatcggcaatgtaggtacaaataac
gaagatatcgaagatcttacacctctcaatgatcgtggcgccattggtgctatttttaaa
gcggacattactcatccttccagctaccgcgcaattgaaaattttaatcaatggctgaag
acgcatcaaattatcgcactttgtggcattgatacacgagcactaaccgttcttatccgt
gaaaaaggtgcacaaaatgccgtcatcgcccatgatttaaacggaaattttgatattaat
gccttaaaagagcgcgcgcaaaaatggcatggccttattaatcttgatcttgcaaaaaaa
gtgacgtcaaaaaaattagtaaactggaatgaaaaaccgtgggtatggaacgaatcttac
agtgaaaataataagaaaaattttcatatcgttgcgattgactacggcattaaacgcaat
attctccgccttatagccgcgcaaggtgcgcacataactgttgtaccagcgcacatgaac
gcagaagaaattttagcgatgaatcccgatggtatttttctatctaacggcccaggggat
ccagccgccacagctgaatatgctgttccaactattaaaacactcattgattgtaatata
cccctttttggcatatgcctcggtcaccagcttcttgctcttgctgttggggctaaaact
gtaaaaatgcatcaagggcaccacggcgctaaccaccccgttaaagacctgactaccgga
aaagtcgagattgcgtcgatgaatcacggttttgcagtagacgcgtcatctttgccgcaa
cacgttgaagagacacatatttccctcttcgatggttcaaactgcggccttaagatcagc
ggaaagcctattttttctgtccagcaccaccccgaagcctctccggggccacaagacagc
cattatctgtttacacgtttccgcgatttagttgtgaattataaaaaaacaatctaa

DBGET integrated database retrieval system