KEGG   Bartonella australis: BAnh1_08700Help
Entry
BAnh1_08700       CDS       T02469                                 

Gene name
trxB
Definition
(GenBank) thioredoxin reductase (NADPH)
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
baus  Bartonella australis
Pathway
baus00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAnh1_08700 (trxB)
Enzymes [BR:baus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     BAnh1_08700 (trxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO FAD_oxidored FAD_binding_2 HI0933_like GIDA NAD_binding_7 FAD_binding_3 Thi4 Trp_halogenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGF74746
UniProt: M1PDS1
Position
complement(1101983..1102927)
Genome map
AA seq 314 aa AA seqDB search
MRSHIRVLIIGSGPAGYTAAIYAARAMLKPVLVTGLQQGGQLTITADVENYPGFADPIQG
PWLMEQMVKQAERMGTEVAYDTIVRADLSKRPFILYGDSGMQYCCDTLIIATGAQARWLG
LESEKTFMGGGVSACATCDGFFYRGKDVLVVGGGNTAVEEALYLSNLAKSVSVIHRRDRF
RAEKILQDRLFARDNVRVIWDHTVEEIIGLQAQSSMGAVMTGARLRNVETGQELIINAEG
IFIAIGHDPAVSLFEGQLRQKEGGYLWTAPDSTATSIAGVFAAGDVADDVFRQAVTAAGR
GCMAALEAERFLET
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgcggtcgcatattcgcgttctgattattggttcagggccggctggttatacagcggca
atttatgcggctcgagcgatgctcaagccggttttggttactgggttgcagcaaggggga
cagctgacaattacggctgacgttgaaaattatccaggttttgctgatccaattcagggg
ccgtggttgatggaacaaatggtgaagcaagccgagcgtatgggaacggaagttgcctac
gatactattgtaagagctgatttatcgaagcgtcctttcatcttatacggcgattcagga
atgcaatattgttgtgacacgcttattattgcgacaggggcgcaggctcgctggcttggc
ttagaaagcgaaaagacttttatgggggggggagtttctgcttgtgccacctgcgatggt
tttttttatcgtggtaaggatgtccttgttgtggggggcggcaatacagctgttgaagaa
gctctttatttatctaatttggctaaaagtgtgagcgtgattcataggcgagaccgtttt
cgtgcggaaaagattctgcaagataggttattcgctcgagataatgtgcgcgtcatttgg
gatcatacggtagaggaaattattggtttacaggctcaatcatcaatgggcgctgttatg
acgggtgcacgcctcagaaatgttgaaacaggccaagaattaataataaatgcagagggg
atattcattgctatcgggcacgaccccgctgtttctttgtttgaagggcaattgaggcaa
aaagaaggcggctatttatggacggccccagattcaacagcgacgagtattgctggcgtt
tttgcagcaggcgatgttgctgatgatgtattccgccaagccgtaaccgcggccggaaga
ggatgtatggcggcactagaggcagagcgatttttggaaacatag

DBGET integrated database retrieval system