KEGG   Bartonella australis: BAnh1_08730Help
Entry
BAnh1_08730       CDS       T02469                                 

Gene name
greA
Definition
(GenBank) transcription elongation factor GreA
  KO
K03624  transcription elongation factor GreA
Organism
baus  Bartonella australis
Brite
KEGG Orthology (KO) [BR:baus00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:baus03021]
    BAnh1_08730 (greA)
Transcription machinery [BR:baus03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription elongation factors
     BAnh1_08730 (greA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GreA_GreB_N GreA_GreB
Motif
Other DBs
NCBI-ProteinID: AGF74749
UniProt: M1N4B9
Position
complement(1106261..1106734)
Genome map
AA seq 157 aa AA seqDB search
MEKFPMTKAGFESLKEELRWRQQQERPRIIEAISEARAHGDLSENAEYHAAKEAQSHNEG
RINELEDYIARAEVINVSRLSGDKVKFGATIKLLDEDTEEEKVYQIVGDQESDVKTGKIS
ISSPIARALIGKQEGDVIEVNAPGGAHNYEIIKIHYA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtttccaatgactaaagccggtttcgaaagtctcaaagaggaattgcgttgg
cgtcagcaacaagagcggccacggattattgaggcgatttctgaggcacgtgcgcacggc
gatctgtcagaaaatgctgaatatcatgctgctaaagaagcacaaagccataatgaaggg
cgtataaatgagcttgaggattatattgcacgggctgaagttattaatgtttctcgcctt
tcaggagacaaagttaaatttggggccactattaagcttttggatgaagatactgaggaa
gaaaaggtttaccagattgttggtgatcaagaatctgatgtgaaaaccggtaaaatttct
atttcttcgcccattgcgcgcgcgcttatcggaaagcaagaaggcgacgtgattgaagtg
aacgcaccaggtggtgcgcataattacgaaatcattaagattcactacgcttaa

DBGET integrated database retrieval system