KEGG   Bartonella australis: BAnh1_08870Help
Entry
BAnh1_08870       CDS       T02469                                 

Gene name
rplY
Definition
(GenBank) 50S ribosomal protein L25/general stress protein Ctc
  KO
K02897  large subunit ribosomal protein L25
Organism
baus  Bartonella australis
Pathway
baus03010  Ribosome
Module
baus_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:baus00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BAnh1_08870 (rplY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:baus03011]
    BAnh1_08870 (rplY)
Ribosome [BR:baus03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    BAnh1_08870 (rplY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_TL5_C Ribosomal_L25p
Motif
Other DBs
NCBI-ProteinID: AGF74761
UniProt: M1PDT4
Position
1121278..1121904
Genome map
AA seq 208 aa AA seqDB search
MSKSYTLKAEIRERVGKGSSRALRRDGLIPAIIYGNKQPPLAVAVSYKEIFYKIHAGGFR
TTVATVEVGKQKIQVLPKDYQLDPVRDVPVHVDFLRISAESVVQVDIPVHFLNEDIAPGI
KRGGVLNIVRHEIECTAPANAIPESIKIDLSGYSIGDSIHISAVQLPEGVVPVIQDRDFT
IATIAAPASMSADDDASEQENGENGINN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagctacactcttaaggccgaaatacgcgagcgggttggtaaggggtcctcc
cgtgcacttcgccgcgacggtcttatcccggccatcatctatggcaacaagcaacctcct
ttagctgttgcggtttcctacaaggaaattttttataaaattcacgcaggcggctttcgt
actacagtcgctactgttgaagtcggtaaacaaaaaattcaggttttacctaaagattac
caacttgatccagttcgtgacgttcctgtgcatgtagattttttgcgtatttctgcagaa
tcggtcgtacaagtggatattcccgttcacttcctcaatgaagatatagccccaggcatt
aaacgaggtggtgttttaaatatcgtgcgccatgaaattgaatgtaccgcgccggcaaat
gccatccctgaatcgattaagattgatctttccggctattctattggcgattctatccat
atttcagcggtacaacttccagagggtgttgtcccggttatccaagatcgagacttcacc
attgcaaccattgcagcccctgctagcatgagtgctgacgacgatgcttcagaacaagaa
aatggtgaaaacggcataaataattag

DBGET integrated database retrieval system