KEGG   Bartonella australis: BAnh1_08890Help
Entry
BAnh1_08890       CDS       T02469                                 

Definition
(GenBank) ErfK/YbiS/YcfS/YnhG family protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-ProteinID: AGF74763
UniProt: M1NTX7
Position
complement(1122726..1123727)
Genome map
AA seq 333 aa AA seqDB search
MGLLSRCIFLIAALATLAGCSMFRSDMSPVSSPRVQNVPEEVRALYGPVTNEPYALPAVD
IAAIDPKFWRQQVDYDTIYPAGTLVVDTNARFLYLVGENGKALRYGIGVGKEGLAFEGEG
TIQYKRRWPNWAPTEAMMAREPERYGHLAQGMPPGPDNPLGARALYLFKNGKDTLFRIHG
SHEAWSIGHAMSSGCIRLLNQDIIDLYGRVPKGSRVVVLQNGEDAFSMPDTRSVVSRGDK
WALSAPDSKSADSQGARRAPSAPDSKSADSQGARWALSAPDSKSADSQGARWASSAPDSK
SLASQDARQASSKSRYRPAMNRRQPDVSSDDLF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggattgttatctcgttgtatttttttaattgcagctcttgcgacgttagcgggctgc
tctatgttccggtcagatatgtcgccggtttcttccccgcgggttcagaatgttccagag
gaagtgcgggctttatatgggcctgtaacgaacgagccttatgcgttgcctgcagttgat
atagcagcaattgatccgaaattttggcgtcagcaagtagattatgacactatttatcca
gctggtacgttggtcgtggataccaatgcgcgttttctttaccttgttggtgaaaatgga
aaagctttacgttacggtatcggtgtaggtaaagaaggtttggcatttgaaggcgagggg
actatacaatataagcgccgttggccgaattgggctcctactgaagctatgatggctcgc
gaaccagagcgttatggccatttagcgcaaggtatgccaccagggcctgataatccactg
ggtgcgcgggcgttgtatcttttcaaaaatggaaaggacacacttttccgtattcatggc
tcacacgaagcgtggtcgattggtcacgctatgtcaagcgggtgtatccgcttactaaac
caagatattattgacctttacggccgtgtccctaaaggctcacgtgtggtcgtgttgcaa
aatggtgaagatgctttcagcatgccagatacgagatcagtggtctcgcggggtgataaa
tgggcactaagtgctccggattcaaaatcggcagattcgcagggtgctagacgggcgcca
agtgctccggattcaaaatcggcagattcgcagggtgctagatgggcgctaagtgctccg
gattcaaaatcggcagactcgcaaggtgctagatgggcgtcaagtgctccagattcaaaa
tcattagcctcgcaggatgctagacaagcatcaagcaaatcaagatataggccggctatg
aatcgtcgacagccggatgttagctcagacgatttattctag

DBGET integrated database retrieval system