KEGG   Bartonella australis: BAnh1_09080Help
Entry
BAnh1_09080       CDS       T02469                                 

Definition
(GenBank) DegT/DnrJ/EryC1/StrS aminotransferase
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase EF1_GNE
Motif
Other DBs
NCBI-ProteinID: AGF74781
UniProt: M1PDV3
Position
complement(1146815..1147933)
Genome map
AA seq 372 aa AA seqDB search
MQFIDLGAQRVRIGDKIDAAIAHVVASGKYILGPKVTEFEDRLADYLGVKNVIACANGTD
ALKMPLMAKNIGPGDAVFCPSFTFSATAEVVALVGAEPIFVDVMPDTFNIDVDKLGEAIE
MIKKEGRLKPKAIISVDLFGLPADYAKIATVAEKESLFVIADAAQSIGGKNGNVMCGACG
DVAATSFYPAKPLGCYGDGGAMMTNDDDLAALLRSILFHGKGKTQYDNVRIGLNSRLDTI
QAAILLEKLIILEDEMEKRTVIAQRYSDGLKDIVVVPEVGEGIRCAYAQYTIKVENRDQL
KAYLQESSIPTMVYYNTPLHLQPAYKNFSYVKGSLAVSESLGNCVLSLPMYPYLSQSDQD
TIIQRIRDFYRS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcattgaccttggggcgcagcgtgtgcgcattggagacaaaattgatgctgca
atcgcacatgtagtagctagtggtaaatatattttgggaccgaaagtaacggaatttgag
gataggttagcagactatcttggcgttaagaacgtgatcgcgtgtgccaatggaactgat
gcattgaagatgcctctcatggctaaaaatattggcccaggtgacgctgtcttttgccct
agtttcactttttccgcgactgccgaagttgttgctttggtgggagcggaacccattttt
gtggatgttatgcctgatacattcaatatcgacgttgataaattgggtgaagcgattgaa
atgatcaaaaaagagggacgcctcaaaccgaaagcaattatttccgtcgatttatttggc
ttaccagctgattacgctaagattgctacggtagctgaaaaagagagcctttttgttatc
gcagatgccgctcaatctataggaggtaaaaatggtaatgttatgtgcggagcttgtggt
gatgtcgcagcaaccagtttttatccggcaaaaccattagggtgttacggtgatgggggt
gccatgatgaccaatgatgacgatctggcggcgcttttacgttcgatcttatttcatggc
aaagggaagacacaatatgacaatgtacgtattggtttaaattcgcggttggatacgatt
caagcggccattttgttagaaaaactcatcatcttagaagatgagatggaaaagcgtaca
gtgattgctcaacgctattccgatggtttaaaagatatcgttgttgttcctgaagttgga
gaaggcattcgttgtgcttatgcgcaatataccattaaggtggaaaatcgcgatcaatta
aaggcttatttacaagaaagttctatccctacaatggtttattataatactccgttgcat
ttacaaccagcttataaaaatttttcgtatgtaaagggctctcttgctgtttctgaatct
ctgggaaattgcgttttaagtttacctatgtatccctatttatcgcagagtgatcaggat
acgattatccagcgcataagggatttttatcgctcttaa

DBGET integrated database retrieval system