KEGG   Bartonella australis: BAnh1_09100Help
Entry
BAnh1_09100       CDS       T02469                                 

Gene name
dppF
Definition
(GenBank) dipeptide ABC transporter, ATP-binding protein
  KO
K02032  peptide/nickel transport system ATP-binding protein
Organism
baus  Bartonella australis
Pathway
baus02024  Quorum sensing
Module
baus_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:baus00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAnh1_09100 (dppF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:baus02000]
    BAnh1_09100 (dppF)
Transporters [BR:baus02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    BAnh1_09100 (dppF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 RsgA_GTPase AAA_16 TniB AAA_5 MMR_HSR1 ATP-synt_ab AAA DUF2813 AAA_19
Motif
Other DBs
NCBI-ProteinID: AGF74783
UniProt: M1NTZ7
Position
complement(1149907..1150689)
Genome map
AA seq 260 aa AA seqDB search
MANYKNIVDVSDLSVTFRRGHEAKMVVKNVSFSIKRGEAYGLIGESGCGKSTILNTLVGL
IPCHSGQFIFDGEKVSQERDKAFLRRIQMVFQDPYASLHPRKMVHTVLSEALTIHGMGNR
KERICDALSAVGLDSSFLYRYPHELSGGQRQRVALARALIIEPEVLLLDEPTSALDVSVQ
AEILNLLKLLREKKQLTYLMVSHDLSVVAHICERVGIMHQGVILEELSNDDLRHLRAKDD
YTKMFFEASIEPVAHRVGGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaattataaaaatattgtcgatgtttctgatttgtctgtgacttttaggcgtggg
catgaggcaaaaatggttgttaaaaatgtctcttttagtattaagaggggtgaggcctac
ggcttaattggtgaatctggatgtggaaaatcgaccattttgaatacattggttgggctt
attccttgtcacagtggacagtttatttttgatggagaaaaagtgtcgcaggagagggat
aaggcttttttgcgccgtattcaaatggtttttcaagacccttatgcttcacttcatcca
agaaaaatggtgcatacagttctttctgaagccctcacgattcatggtatgggtaatcgg
aaggaacggatatgtgatgctttgagtgcggttggtctagactcttcatttctttatcgt
tacccacatgagttatccggtgggcaacgccagcgcgttgctcttgcgcgtgctttaatt
attgagccagaagttttgttactcgacgagccaacatctgcattggatgtatcggtacag
gccgaaattttgaatttgctgaaattactgagagagaaaaaacaacttacttatttgatg
gtgtcccacgatctttctgttgttgcacatatatgcgaacgtgttggaattatgcatcaa
ggggttattcttgaagagttaagtaacgatgatttgcgtcatttacgtgcaaaggatgat
tatacaaagatgttttttgaggctagcattgagcctgttgctcatagggttggggggggc
tga

DBGET integrated database retrieval system