KEGG   Bartonella australis: BAnh1_09290Help
Entry
BAnh1_09290       CDS       T02469                                 

Gene name
yidC
Definition
(GenBank) putative inner membrane protein translocase component YidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
baus  Bartonella australis
Pathway
baus02024  Quorum sensing
baus03060  Protein export
baus03070  Bacterial secretion system
Module
baus_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:baus00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    BAnh1_09290 (yidC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BAnh1_09290 (yidC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAnh1_09290 (yidC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:baus03029]
    BAnh1_09290 (yidC)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:baus02044]
    BAnh1_09290 (yidC)
Mitochondrial biogenesis [BR:baus03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BAnh1_09290 (yidC)
Secretion system [BR:baus02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   BAnh1_09290 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YidC_periplas 60KD_IMP
Motif
Other DBs
NCBI-ProteinID: AGF74802
UniProt: M1NZE1
Position
1175534..1177372
Genome map
AA seq 612 aa AA seqDB search
MEYNRNFFIAIGLSFVVFAAWHFLYVAPYQAKLQQTRMIAQELSKQNSASPVTGAPSSKA
APESAAQPVADRPMTPEIRSAELAKTNRIAIKTSELEGSINLIGAQFDDLLLKKYHLTVD
KKSPKIALLNPNGFTTTYLAEFGFTSSSLAAKTLPQSDTQWQLEGNNATLTPSTPVVLVY
NNGQGQIFRRTLSVDDHYMFTIEDSIRNESDSSIHLSPYARVARAAPPEHANATYLLHEG
MIGVVGDSLKTEKYKALAELSPNPDNGQKSVIFSKATGGWIGITDKYWAVAIVPPQDEEY
TSRFIYFDQLNTHYQSDLLGALLTIAPHETKTITNHLFAGAKQVEIINSYQDQLNINKFG
LLIDWGWFDFITKPMFALIDILYKQTGNFGIAILLVTVLLKTLLFPLANKSYKSMARMKL
VQPMMSEIKEKYADDRVKQQQAIIELYKTQNINPLAGCWPILIQFPIFFALYKVLYITIE
MRHAPFFGWIQDLAAPDPTSIFNLFGLLPYAVPTFLVLGVWPLIMGITMFLQMQMNPSPA
DPTQAMIFTWMPVVFTFMLASFPAGLVIYWAWNNTLSIIQQSIMMKRQGVKIELLNNLRA
IVKRGSKKETHK
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atggaatataaccgcaactttttcatcgctattgggctgtcttttgttgttttcgctgcg
tggcattttctttatgttgctccctaccaagcaaagttgcagcagacgcgaatgatcgca
caggaattatcaaaacaaaattcagcatcgcccgtcactggcgcaccttcttccaaagct
gcgccagaaagtgcggcgcaacctgtagctgatcgtccaatgacacctgaaatccgtagc
gcggagttagctaagacaaaccgtattgcaattaaaaccagcgaacttgaaggctctatc
aatcttattggcgcacaatttgatgaccttttgctcaaaaaatatcatctgacagttgac
aaaaaatcgcctaaaattgctttattgaatcccaatggttttaccacgacttatcttgcc
gaatttggtttcacaagctcgtctttggctgcaaaaaccttgccacagtctgacacgcaa
tggcaattagaagggaataatgcgacgctaacaccttcaacaccagttgttttggtttac
aataacggacaaggacaaattttccgccggaccctttctgtcgacgatcattacatgttt
actattgaggattctatcagaaatgaaagcgatagctctattcatctctcgccctatgca
cgagtcgcgcgtgctgccccgccggaacacgcaaatgcaacttatttgctccacgaaggt
atgatcggtgttgtgggtgattcgcttaaaactgaaaaatacaaagccttagcagagctc
agccctaacccagacaatggacaaaaaagcgtaatcttttctaaggccacaggaggatgg
attggtattaccgataaatattgggctgtagctattgtccctccacaagatgaagaatac
acaagccgttttatttattttgatcagttgaatacgcattatcaatccgacttgcttggt
gcgctcttgacaattgctccccacgaaacaaaaactatcacaaaccatctctttgctggc
gcaaagcaggttgaaattattaatagttaccaagatcagttaaatattaataagttcggc
cttttaattgattggggttggttcgactttattacgaaaccgatgtttgcccttattgac
attctttataaacaaacgggcaattttggcattgctatcctcctcgtcacggtgctctta
aaaaccctcctgttcccgctcgctaataaatcttataaatctatggcacggatgaaatta
gtgcaaccaatgatgtcagaaatcaaagaaaagtacgcagatgaccgtgttaaacaacaa
caagccataatagaattgtataagacgcaaaacattaatcctctcgcggggtgctggccg
atactgattcaattcccaatattttttgccctttacaaagtcctttatatcaccattgaa
atgcggcatgcgcctttttttggttggattcaggacttagcagccccggacccaacttcc
atttttaacttatttggcttattgccctacgcagtgccaacgtttcttgtcctcggtgta
tggcctttaatcatggggataacgatgttcttacagatgcagatgaatccatcgcccgca
gatccaacgcaggctatgatctttacttggatgccagttgtctttacctttatgctagcg
tcatttcctgctggtctcgttatttattgggcgtggaacaatacattatcaattattcaa
caaagcatcatgatgaagcgtcagggtgtgaaaattgagcttctgaataatctcagagct
attgtgaaaagaggatcgaaaaaagaaacacacaaatga

DBGET integrated database retrieval system