KEGG   Bartonella australis: BAnh1_09320Help
Entry
BAnh1_09320       CDS       T02469                                 

Gene name
dapB
Definition
(GenBank) dihydrodipicolinate reductase
  KO
K00215  4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
baus  Bartonella australis
Pathway
baus00261  Monobactam biosynthesis
baus00300  Lysine biosynthesis
baus01100  Metabolic pathways
baus01110  Biosynthesis of secondary metabolites
baus01120  Microbial metabolism in diverse environments
baus01130  Biosynthesis of antibiotics
baus01230  Biosynthesis of amino acids
Module
baus_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:baus00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAnh1_09320 (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BAnh1_09320 (dapB)
Enzymes [BR:baus01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     BAnh1_09320 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DapB_C DapB_N Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AGF74805
UniProt: M1P4M1
Position
1179371..1180177
Genome map
AA seq 268 aa AA seqDB search
MRLTVVGANGKMGRGLLTALQNKKGAELGAALVRKGSPFVGKDVSALIGPDCLGIRITDD
VEEAFSNTEGVLDFSGPQASVAYARYAAQKGIVHIIGTTGFSEKEDAQIADFAKHTAIVK
SGNMSLGINLLANLVTKVAKTLKSDDFDIEIYEMHHSGKVDSPSGTALLLGNAAAEGRNV
ALKDVSVSDRSNCTGKREKGSIGFACSRGGTVVGDHSVIFAGQNERIILSHAAQERSIFA
NGAIKAALWAQKRKNGLYSMLDVLGLND
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcacagttgtcggtgcgaacgggaagatggggcgcgggctgcttacggctctc
cagaataaaaaaggtgcagagctcggcgccgctcttgtgcgcaaaggttccccgtttgta
ggaaaagacgttagtgcgttaatcggcccggactgtctcggaattcgtatcaccgatgac
gtggaagaggccttttctaacacagagggcgttttagatttttctgggccacaagccagt
gttgcctacgcgcgttatgctgcccaaaaaggaattgttcacattatcggaacaaccgga
tttagcgaaaaagaagacgcacaaattgcggattttgcaaagcatacagccattgtcaaa
tctggaaatatgagtcttgggattaatcttttggccaatcttgttacaaaagtggccaaa
acattaaaatctgatgattttgacattgaaatttacgaaatgcaccattccggcaaagtt
gattctccctctgggacagcccttcttttagggaatgcggcggccgaaggccgcaatgtt
gcgcttaaagacgttagtgtcagtgatcggagtaattgcacaggcaaacgtgaaaaaggc
agcatcggttttgcttgctcacgaggcggaacagtcgtcggcgaccacagtgttattttt
gcaggtcaaaatgagcgcattattctttcacacgcggctcaagaacgctctatttttgct
aatggcgcgataaaggccgctttgtgggcacaaaaacgtaaaaatggtctttattcaatg
ctcgatgttttaggactaaatgattaa

DBGET integrated database retrieval system