KEGG   Bartonella australis: BAnh1_09380Help
Entry
BAnh1_09380       CDS       T02469                                 

Definition
(GenBank) anti-repressor protein
  KO
K07741  anti-repressor protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AntA ANT Tht1 DUF3791
Motif
Other DBs
NCBI-ProteinID: AGF74811
UniProt: M1PDY1
Position
complement(1184335..1185078)
Genome map
AA seq 247 aa AA seqDB search
MTLITINEKQIGQETVQTVNARDLHAFLGVTSRFNDWIKNRINDFGFVENRDFVTLTKNL
VSGGKQKEYHLSLNMAKELSMVERNKKGRQARQYFIECERRATAPTNVQEILNDPNHLKT
LLLNNVEKVIALESKVKEQEPKVAAYEHLTRADGTMCITNAAKALEMRPRDLFAYLSQNK
WIYRRMGNTAYIPYQEKIQSGLMDCPTKVISRGDGSEKIAVQARVTSKGLARLSEILSGN
STLREAV
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgactctcattacaattaatgaaaaacaaattgggcaggagactgttcaaacggtaaat
gcgcgcgacttacacgcatttttaggggtaacaagccgctttaatgattggattaaaaac
cgcattaatgactttggattcgttgaaaaccgggactttgtaacgcttactaaaaattta
gtaagcggtggaaaacagaaggaatatcacctctcactaaatatggcgaaagagttatcc
atggttgaacgcaacaagaagggcaggcaagcacgacaatacttcattgagtgtgaacgt
cgggccacggctcctacaaatgtccaggagattttaaacgacccaaaccatctaaagact
ttgctcttgaataatgttgaaaaagttattgccttggaaagcaaggttaaagagcaagag
cccaaggttgcagcctatgagcacttaaccagggcagatggtaccatgtgtatcactaat
gctgctaaagccttagagatgagaccgagagatctattcgcctatctgtcgcagaataaa
tggatctacaggcgcatggggaatactgcctatatcccttaccaggagaagatacagtca
ggcctcatggattgtcctacgaaagttattagccgtggtgacggaagtgagaagatcgct
gttcaggcacgtgttacttcaaaggggctggcacgtttatcggagattctttcgggaaat
tcaacgctgagggaggccgtatga

DBGET integrated database retrieval system