KEGG   Bartonella australis: BAnh1_09450Help
Entry
BAnh1_09450       CDS       T02469                                 

Gene name
gpU2
Definition
(GenBank) phage tail protein U
  KO
K06906  uncharacterized protein
Organism
baus  Bartonella australis
Brite
KEGG Orthology (KO) [BR:baus00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BAnh1_09450 (gpU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_P2_GpU
Motif
Other DBs
NCBI-ProteinID: AGF74817
UniProt: M1PBX3
Position
complement(1189306..1189683)
Genome map
AA seq 125 aa AA seqDB search
MMLALGCFIFSIETAAYQTLDMSYEVPWVEQGRLGRKTALQLPAAANVEFSLTGVIYPDF
KGGYGQLEYLRHMAHGGPHILVTGQGLILGKFVILSVSETQSVFHQNGLPKKQEFTVHLK
EYGED
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggctttagggtgttttattttttcgattgaaacagcagcctatcaaacactt
gatatgtcttacgaggtcccgtgggttgagcaagggcgattgggacgaaaaacggcactt
caattgcctgctgctgcaaatgtggaattttctttaacaggcgtgatttatccagatttc
aaaggcggttatggacagctagaatatttgcggcacatggcgcatgggggacctcacatc
ctggtgacgggtcagggcctgattttaggcaaatttgtcatcctttccgtgagcgaaacg
cagagcgtttttcatcaaaatggccttcccaagaaacaagaatttaccgtgcatttaaaa
gaatatggtgaagattaa

DBGET integrated database retrieval system