KEGG   Bartonella australis: BAnh1_09500Help
Entry
BAnh1_09500       CDS       T02469                                 

Gene name
vapA
Definition
(GenBank) virulence-associated protein A
  KO
K21498  antitoxin HigA-1
Organism
baus  Bartonella australis
Brite
KEGG Orthology (KO) [BR:baus00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:baus02048]
    BAnh1_09500 (vapA)
Prokaryotic defense system [BR:baus02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HigB-HigA
    BAnh1_09500 (vapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_26 HTH_31 HTH_23 HTH_8 MarR_2 HTH_Crp_2 YdaS_antitoxin HTH_7
Motif
Other DBs
NCBI-ProteinID: AGF74822
UniProt: M1NZG2
Position
complement(1194122..1194448)
Genome map
AA seq 108 aa AA seqDB search
MTTRNPERCPSHPGEILAEALENLDISKTEIARILQISRQHLHGILKGARPVTAATAARI
GKLLGNGPALWLQLQANYDTWHALRDIDVSSIPTLTVGRVDAQIERSR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgactacacgcaatcccgaacgttgcccttctcatccaggagagattttagctgaagct
ttagaaaatctagatataagtaaaacagaaattgctcgaattcttcaaatatcacgccaa
catttgcatggcattcttaagggggcacgtcctgttacagcggctacagctgcacgtatc
ggcaaacttttgggcaatggaccagctttatggttacagttgcaggcaaattatgacaca
tggcatgcattacgagatattgatgtttcttccattccaacattaacggttggtagggtg
gacgcgcaaatagaacgtagccgctag

DBGET integrated database retrieval system