KEGG   Bartonella australis: BAnh1_09520Help
Entry
BAnh1_09520       CDS       T02469                                 

Definition
(GenBank) putative phage tail fiber protein
Organism
baus  Bartonella australis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collar PTR
Motif
Other DBs
NCBI-ProteinID: AGF74824
UniProt: M1N4J8
Position
complement(1194931..1195851)
Genome map
AA seq 306 aa AA seqDB search
MEKTKKLNMELPKEGRFISSEFPILRENLVKIDQAIDDIDEKADSKASSQHLHAMEDVVG
LETALKNKMAADKTFSFADLSDVEGARDAANNYVLYKLNDDHFTFGSAISLLGEHQHKAE
DIIGLKDSYQELHDEIEREIKEIFPSGFIATFAMKTVPSGWLLCDGATYKRTDYPRLFKA
IGDQWGKDSDTTFKVPDFRGVFLRGFDNGRGLDQEREFAKYQPDSIRSHTHNCTIDAAGG
HAHKFWYSEVDTGASDIGQRNPRYKRQTGSRMTESAGVHTHRATISSTGGAETRPVNATV
IYAIKA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacaaaaaagttaaatatggaactaccaaaagaaggtcgttttatcagttct
gaatttccgatcttgcgtgaaaatttagtaaagattgatcaggcgattgacgatattgat
gaaaaggcggatagcaaagcatcttcacagcatctccacgcgatggaagatgtcgtggga
cttgagacagctctcaagaataaaatggcagcagataagactttttcatttgctgattta
agtgatgtagaaggcgctagggatgcggcgaataattatgttttatataaattaaatgat
gatcattttacctttggtagcgctatttcactcttaggagaacatcaacacaaagcagaa
gatattattgggcttaaggattcttatcaggagctccacgatgaaattgagcgagaaata
aaggaaattttcccctctggattcattgccacatttgccatgaagacagtgccaagcggc
tggcttttatgcgatggcgcaacttataaacgtacagattatccgcgattattcaaggca
ataggggatcaatggggaaaagacagtgatacaacctttaaagttcctgatttcagaggg
gtgtttttacgtggctttgataatggtcgtggtctagatcaagagagagaatttgctaaa
tatcagccagatagcataaggtcgcacacgcataattgcaccattgatgcagcgggcggg
catgcacacaaattttggtatagtgaagttgatacaggtgcttcggatattggtcaaagg
aatcctcgttataagaggcaaacgggatcacgtatgacagaatctgctggtgtgcatacg
cacagggcaaccatttcttcaacaggcggagcagaaacgcggcctgtgaatgcgacagtt
atttacgccataaaggcatga

DBGET integrated database retrieval system