KEGG   Bordetella avium: BAV0932Help
Entry
BAV0932           CDS       T00695                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bav  Bordetella avium
Pathway
bav00790  Folate biosynthesis
bav01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAV0932 (folP)
Enzymes [BR:bav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BAV0932 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: CAJ48543
UniProt: Q2KVQ7
Position
992638..993474
Genome map
AA seq 278 aa AA seqDB search
MVHSFLCGRFELDLGRPLVMGIVNVTPDSFSDGGLHNDPDAAIAHAHALIAEGAHILDLG
GESTRPGAPAVSADEEKRRLLPVIEALRDCGVPLSIDTFKPEVMRAVLDVGADMINDIYG
FRLPGAVQAVADSRCGLCVMHMQGEPGTMQDAPQYADVLGEVRGFLDARADCLLAASVDA
RRIVLDPGFGFGKTANQNYQLLRGLDSLRDYPLLIGVSRKSMIGAATGRPVGERLPGSIA
AALACVARGAAIVRVHDVAATVDALKVWQAAEQGAIFS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggtccattcttttttgtgcgggcgctttgagctggatctcgggcgcccgcttgtcatg
ggtattgtcaatgtcacgcctgattccttctcggatggcggcctgcacaacgacccggac
gcagccatcgcgcacgcccatgccctgattgcagaaggcgctcatatcctcgatctgggc
ggtgaatccacacgccctggtgcgccggctgtgtcggccgacgaggaaaagcggcgtttg
ctgcccgtcatcgaggcgctgcgtgattgcggtgtgccgctttccatcgacaccttcaag
cctgaggtcatgcgtgcggtgctcgatgtcggcgccgacatgatcaacgacatctatggt
tttcgtctgccgggcgcggttcaagctgttgcggactcgcgttgcggcctgtgcgtcatg
catatgcagggcgaaccgggcacgatgcaggacgcgccgcaatacgccgatgtcctgggt
gaggtgcgcggtttccttgatgcccgggcagactgcctgctggccgcctcggtggatgcg
cggcgcatcgtgctcgaccccggcttcggcttcggcaaaaccgcgaaccagaattatcag
ttactgcgcgggctggacagcttgcgcgactatccgctgctgattggtgtctctcgcaaa
tccatgatcggcgccgccaccggacggcccgtcggcgagcgtctgcccggcagcattgcc
gccgccctggcctgtgtggcccgtggcgctgctatcgtgcgcgtgcacgatgtggccgcc
acggtggatgccctgaaggtctggcaggcggctgaacaaggagccatcttttcatga

DBGET integrated database retrieval system