KEGG   Bordetella avium: BAV1079Help
Entry
BAV1079           CDS       T00695                                 

Definition
(GenBank) BioY-family membrane protein
  KO
K03523  biotin transport system substrate-specific component
Organism
bav  Bordetella avium
Pathway
bav02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bav00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BAV1079
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bav02000]
    BAV1079
Transporters [BR:bav02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter
    BAV1079
   Energy-coupling factor transporter
    Substrate-specific components
     BAV1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BioY ECF_trnsprt ECF-ribofla_trS
Motif
Other DBs
NCBI-ProteinID: CAJ48688
UniProt: Q2KUS5
Position
1153844..1154395
Genome map
AA seq 183 aa AA seqDB search
MTNRNLVLAALFAALMVVLSLMPPVPLPAIPVPVTLQTLGVMLAGIMLGPWRGAAACLLY
LVLAAIGLPVLPGGRGGLGVFVGPTGGFLMGMLLGVVVAGLLARALARGGMWRMLGGYLL
ACLVGGVAAVYAVGVPWLAAVTQMGLAKAALAVVVFLPGDLVKALVAAWVAWRVERVWPL
LRR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagaaatttggttctggcggcgctgttcgccgccttgatggtggtgttgagc
ctgatgccgccggttcctttacccgccatccccgtccctgtgacgctccagacgctgggc
gtgatgctggcgggcattatgctcggcccatggcgtggcgcggccgcttgcctgctgtat
ctggtgctggccgcaatcggtctgccggtgctgcccggtgggcggggcggcctcggcgta
ttcgtagggcccactggcggttttctgatgggcatgttgctgggtgtggtggtcgccggt
ctgctggctcgcgcactggcccgtggcggcatgtggcgcatgctcggcggctatttgctg
gcctgcctcgtggggggtgtcgcggcggtatatgccgtgggcgtaccttggctggccgcc
gtaacgcagatgggcctggccaaagccgcattggccgtggtggtgtttttgcctggcgac
ctggtgaaggcgctggtcgcggcttgggtcgcctggcgtgtcgaacgggtgtggccgttg
ttgcggcgttga

DBGET integrated database retrieval system