KEGG   Bordetella avium: BAV1102Help
Entry
BAV1102           CDS       T00695                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bav  Bordetella avium
Pathway
bav00260  Glycine, serine and threonine metabolism
bav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01130  Biosynthesis of antibiotics
bav01230  Biosynthesis of amino acids
Module
bav_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV1102 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAV1102 (trpB)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAV1102 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAJ48711
UniProt: Q2KUL8
Position
<1178608..1179807
Genome map
AA seq 399 aa AA seqDB search
VKPYDLPDEKGHFGPYGGVFVAETLMHALSELRTAYDKYRVDPTFIEEFNYELRHFVGRP
SPVYHAARWSKKLGGAQIWFKREDLNHTGAHKINNCIGQALLARRMGKPRVIAETGAGQH
GVASATVAARYGMECVVYMGSEDVRRQASNVYRMKLLGAKVVPVESGSRTLKDALNEAMR
DWVTNIENTFYIIGTVAGPDPYPRMVRDFQTVIGKECLVQMPADAGRQPDYVVAAVGGGS
NALGIFHPYIPHEDVQLIGVEAAGEGMETGRHAASLAAGQVGVLHGNRTYVMQNADGQVQ
ETHSVSAGLDYPGVGPEHAWLKDSGRASYVGITDDEALAAFHDCCRIEGIMPALESSHAI
AQAVKMAPTLPRDKIILVNLSGRGDKDMHTVAERAGLEL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccttacgaccttccggacgagaaggggcatttcggcccctatggtggcgttttc
gttgccgagacgctcatgcacgccttgagcgagctgcgaaccgcctacgacaagtaccgt
gtcgatccgacgtttatcgaagagttcaactatgagctccgacatttcgtcggccggccc
agccctgtctatcatgctgcccgatggtcgaaaaagctgggcggcgcccagatctggttc
aagcgcgaagacctcaaccataccggcgcgcacaagattaataactgtatcggtcaggcc
ctgctggccagacgcatgggcaagccccgcgtgattgccgagactggcgcgggccagcac
ggcgtggccagcgctacggtcgcggcacgctatggcatggagtgcgtggtgtatatgggc
agcgaagatgtccgccgccaggcctccaacgtttatcgcatgaagctcttgggcgccaag
gtcgtgccggtggagtcgggctcgcgcaccctgaaagacgcgctcaatgaagccatgcgc
gactgggtcaccaacatcgagaacactttctatattatcggcaccgtcgccggtccggac
ccctatccgcgcatggtgcgggatttccagaccgtaatcggcaaagagtgtctggtgcaa
atgcctgccgacgccggccgtcagcccgactatgtcgtcgcggcggtggggggcggctcc
aatgctttgggcattttccatccctatattcctcacgaggatgtgcagctcatcggtgtc
gaggccgcaggcgaaggcatggaaaccggccgtcacgcggcatcgctggctgccggtcag
gtgggcgtgctgcatggcaaccgcacctatgtgatgcagaacgccgatggtcaggttcag
gaaacgcattccgtttccgccggcctggattatcctggcgttggtcccgaacatgcctgg
ctgaaagacagcggccgcgccagctacgtcggcattactgacgacgaggccctggccgcg
tttcatgattgctgccgtatcgagggcatcatgccggcgctggagtcctcccacgccatt
gcacaggccgtcaaaatggcgccgacgctgccgcgcgataagatcattctggtcaacctg
tcgggccgtggcgacaaagatatgcataccgttgccgaacgcgcgggccttgagctgtaa

DBGET integrated database retrieval system