KEGG   Bordetella avium: BAV1103Help
Entry
BAV1103           CDS       T00695                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bav  Bordetella avium
Pathway
bav00260  Glycine, serine and threonine metabolism
bav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01130  Biosynthesis of antibiotics
bav01230  Biosynthesis of amino acids
Module
bav_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV1103 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAV1103 (trpA)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAV1103 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAJ48712
UniProt: Q2KUL5
Position
1179814..1180668
Genome map
AA seq 284 aa AA seqDB search
MSQRIAAAFSRVAEAGRASALIPYIAAGDPSPAATVPLMHGLVKAGADVLELGVPFSDPM
ADGPVIQRAAERAIAQGMGLSLVLQAVAEFRLTDSITPVVLMGYANPIERMGQEAFAQAA
CDAGVDGVLVVDYPPEEMDEFGVALNRAGVAPIFLIAPTTTEARMQSIGRVARGYAYYVS
LKGVTGSGSLNTEDVAQRLAVIRRHIGDLPVGVGFGIRDAESASRIALHADAVVIGSKLI
ETMEQAIVNVPPAEQTDAAVKAASQWLGGIRAALDQVKRERAQG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacgaattgccgccgctttttcccgtgtcgccgaggcgggtcgcgcctcggct
ttgattccctatatcgcagcgggcgatccctcgcccgctgcgaccgtaccgctgatgcac
gggctcgtgaaggccggcgccgatgtgctcgaactgggtgtgccgttttcagatccgatg
gctgatggcccggtgatccagcgcgccgcagagcgcgccatcgcgcagggcatgggcttg
tcgctagtgctgcaagccgtggccgagtttcgtctcacggacagcatcacgcccgtcgtg
ctgatgggttatgccaacccaatcgaacgcatggggcaagaggcttttgcgcaggcagcc
tgcgatgccggcgtggacggcgtgctggtggtcgattatccccccgaagaaatggatgag
ttcggcgtcgccctgaatcgggccggtgtcgccccgatttttctgattgcccccaccacc
accgaggcgcgcatgcagtccatcggccgggtggcgcgaggttatgcctactacgtgtcg
ctcaagggcgtcacgggctcgggcagcttgaataccgaggatgtggcgcaacgtctggcc
gtcatccgccgccacatcggcgacctgccggtgggggtgggtttcggcattcgtgatgcc
gagagcgccagccgcattgcgcttcatgctgacgccgtcgttattggcagcaaactcatc
gaaaccatggagcaggctatcgtcaatgtgccgcctgctgaacagaccgacgccgcggtc
aaggccgccagccagtggctgggcggcatccgcgccgcgctggatcaagttaaacgagag
cgcgcgcagggctga

DBGET integrated database retrieval system