KEGG   Bordetella avium: BAV1149Help
Entry
BAV1149           CDS       T00695                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bav  Bordetella avium
Pathway
bav00010  Glycolysis / Gluconeogenesis
bav00620  Pyruvate metabolism
bav00640  Propanoate metabolism
bav00680  Methane metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01130  Biosynthesis of antibiotics
bav01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAV1149 (acs)
   00620 Pyruvate metabolism
    BAV1149 (acs)
   00640 Propanoate metabolism
    BAV1149 (acs)
  Energy metabolism
   00680 Methane metabolism
    BAV1149 (acs)
Enzymes [BR:bav01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BAV1149 (acs)
Lipid biosynthesis proteins [BR:bav01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BAV1149 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAJ48757
UniProt: Q2KY33
Position
1224769..1226748
Genome map
AA seq 659 aa AA seqDB search
MSNAIQSVLVENRVFPPPERAVEGASISGMEAYRALCQEAEQDFNGFWARHARENLQWTK
PFTEVLDESNAPFYRWFGDGELNVSANCLDVHLGNGNADKTAIIFEADDGQVEKVSYREL
LARVCRFANGLKSLGYKKGDRAIIYMPMSIEAVVAMQACARLGVTHSVVFGGFSAKSLQE
RIVDVGASLVITADEQVRGGKVIPLKPAVEEAFAMGGCDAVSKVIVYRRTGGKIAWQEGR
DLWMHEVQAGQPDTCEPVPVEAEHPLFILYTSGSTGKPKGVQHASAGYLLWSLLTVKWTF
DARASDVYWCTADVGWITGHTYITYGPLAAGLTQVVFEGVPTFPNAGRFWDMIARHKVSV
FYTAPTAIRSLIKASEAAPQTHPRNFDLNSLRIIGTVGEPINPEAWIWYHKQVGQERCPI
VDTWWQTETGGHMITPLPGATPLKPGSCTLPLPGITAAIVDETGADVEQGNGGFLVIKRP
WPSMIRTIWGDPERFKKSYFPAELRGYYLAGDGAQRDADGYFWIMGRIDDVLNVSGHRLG
TMEVESALVAHELVAEAAVVGRPDDTTGEAVVAFVVLKGARPEGEAAQAIAKQLRDWVAK
EIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRVVAKGEEVTQDVSTLENPAILEQLAKPL
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgccatccaatccgtcctggtggaaaaccgtgtgtttcccccgcccgagcgc
gccgtcgagggcgccagcatttccggcatggaggcctatcgggcgctatgccaggaagcc
gagcaggatttcaacggtttctgggcgcgccatgcgcgcgagaacctgcaatggaccaag
cctttcaccgaggtgctggacgaaagcaacgcgccgttttaccgctggtttggcgacggt
gaactgaatgtgtcggccaattgtctggatgttcatctcggcaatggcaacgccgacaag
acggccatcattttcgaggccgatgacggccaggtcgagaaagtcagctaccgtgagctg
ctggcccgtgtctgccgcttcgccaatggcttgaagtccctgggctacaagaagggcgat
cgcgccatcatctacatgcccatgtcgattgaggccgtggtggccatgcaggcctgcgcc
cgtttgggcgtgacccactcggtggtgttcggcggtttctcggccaagagtttgcaggaa
cgcattgttgacgtgggcgcgtcgcttgtcatcacggccgatgagcaggtgcgcggcggc
aaggtcattccgctcaagcctgccgttgaagaagcctttgcgatggggggctgcgatgcg
gtctccaaggtgatcgtttaccgccgcaccggcggcaagatcgcctggcaagagggccgt
gatctctggatgcatgaggtgcaggccggccagccggatacctgcgagccggtgccggtc
gaggctgagcatccgctgttcatcctctatacctcgggctcgacaggaaagcccaagggc
gtgcagcatgcttcggccggttatctgctgtggtccttgctgacggtcaagtggacgttt
gacgctcgcgccagcgatgtctattggtgcacggcggatgtgggctggatcaccggtcac
acttatattacctatggccccctggcggcagggttgacgcaggtcgtgttcgagggggtg
ccgactttccccaatgcaggccgtttctgggacatgattgcgcgtcataaggtcagcgtt
ttttacaccgcgcccactgccatccgttcgctcatcaaggcatcggaggccgcaccgcaa
acgcatccgcgcaacttcgatttgaacagtctgcgcattatcggcacggtgggcgaaccc
attaatccggaggcttggatctggtatcacaaacaggtcggccaagagcgttgcccgatt
gtcgatacttggtggcagaccgagacgggtggtcacatgattacgcccttgccaggcgcc
acgccgctcaagccggggtcgtgcaccttgcctttgcccggcattactgcggccatcgtc
gatgagacgggggccgatgtcgagcagggtaatggcggtttcctggtcatcaagcggccc
tggccttcgatgatacgcaccatctggggcgaccccgagcgtttcaaaaagagctatttc
cctgctgagctgcgcggctattatctcgcgggcgacggcgcgcagcgcgacgcggacggc
tatttctggatcatgggtcgcatcgacgacgtgcttaacgtctccggccaccgcctgggc
acgatggaagtcgagtcggcgctggttgcgcatgagctggtggccgaggcagccgtggtg
gggcgtcctgatgacaccactggcgaagccgtcgtggcttttgtggtgctcaaaggcgcg
cgtccggaaggcgaagcggcgcaagccatcgccaagcaattgcgtgattgggtcgccaag
gaaatcggccccattgccaagcccaaggacatccggtttggcgacaacctgcccaagacg
cgttctggcaagatcatgcgccgtctgttgcgcgtggtggccaagggcgaagaagtgacg
caggatgtgtctacgctggaaaatcctgccattcttgaacaattggccaaaccgctttaa

DBGET integrated database retrieval system