KEGG   Bordetella avium: BAV1803Help
Entry
BAV1803           CDS       T00695                                 

Gene name
plcN2
Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bav  Bordetella avium
Pathway
bav00562  Inositol phosphate metabolism
bav00564  Glycerophospholipid metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BAV1803 (plcN2)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAV1803 (plcN2)
   00565 Ether lipid metabolism
    BAV1803 (plcN2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BAV1803 (plcN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bav02042]
    BAV1803 (plcN2)
Enzymes [BR:bav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BAV1803 (plcN2)
Bacterial toxins [BR:bav02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BAV1803 (plcN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756
Motif
Other DBs
NCBI-ProteinID: CAJ49411
UniProt: Q2L0W2
Position
complement(1889792..>1891963)
Genome map
AA seq 723 aa AA seqDB search
VTSPKDLIHVGKRRFLRNAAVSTAGLAALSMFPPSIRRALAIPANNRTGTINDVEHVVIL
MQENRSFDMYFGTYKGVRGFGDRITIPLANNRSVWEQSNGTRVVMPYHLDSTQGNAQRVA
GTPHDYPDAQNAWDGGRMNQWPRYKQNQSMGYYKQTEMEFQFALAEAFTLCDAYHCASHG
GTNTNRLFHWTGTNDPLAQGGGPSTRNRLDSLGASTAGWSWKTYPERLQEAGVSWRVYQN
LPDNFTDNPLAGFQQYRRANELAGNSANGSPYTPWTPAADGGNPLYKGVANTMPDGGFLQ
ALRDDVANGTLPQVSWIVAPADYSEHPGPSSPVQGAWYIQAALDALTSNPAIWSKTVFLI
NFDENDGYFDHVPPPAAPSINPDGSMAGASTVNTDLERHTRASVSDAPDNRVYGPGPRVP
MYVVSPWSRGGWVNSQAFDHTSVLRFLEARFGVAELNISPWRRAAMGDLTSAFNFVTPND
DTLPNLNLLTRGGSDQLRADQQAKAAVPLPAEANQVKPVQEPGVRPSRALPYELHTSART
QSSSGAIWLIFANTGEATGVFHVYDRLHLDRLPRRYTVEPGKQLEGSWDASADGGKYDLW
VLGPNGYHRHFTGDLALARTAALDAETRVCYDIANGDVYVTLSNNGKTACNFDITPNAYY
VNNERWTLTVPPGGKVDQHWALANSGAWYDFTVRMTEDPSYARRFAGRVETGKPSVTDPA
MGQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccccaaaagacctgatccacgttggcaagcgccgcttcctgcgtaatgcggcg
gtgtccaccgccggcctggccgccttgtcgatgttccccccctcgatccgccgcgcgctg
gccattcccgccaacaaccgcaccggcacgatcaacgacgttgaacacgtggtcatcctg
atgcaggagaaccgctcttttgatatgtatttcggcacctataaaggggtgcgcggcttt
ggcgaccgtataacaatcccgctggcgaacaaccgcagcgtgtgggagcaaagcaatggc
acgcgcgtggtaatgccttaccacctggacagcacgcaaggcaatgctcagcgggtggcc
ggcacgcctcacgactatccggatgcccaaaacgcctgggatggcggccgcatgaaccaa
tggccccgctacaagcagaatcaatcgatgggctattacaagcaaacggaaatggaattt
cagtttgcgctggccgaagccttcacgctgtgtgacgcctatcattgcgcatcgcacggc
gggacgaacaccaaccgactcttccactggaccggcaccaacgacccgctggcgcagggc
ggcggcccctcgactcgcaaccgtctggacagcctcggagcatcgacggcgggttggagc
tggaaaacctatcccgagcgtctgcaggaagcgggcgtgagctggcgggtctaccaaaac
ctgccggacaacttcaccgacaatccgctggccggtttccaacagtaccgccgcgccaac
gagctggccggcaacagcgcaaacggttcgccctacaccccctggacgccggccgctgat
ggcggcaatccgctgtacaaaggcgtggccaacaccatgcccgacggcggctttctgcaa
gccttgcgcgacgacgtcgccaatggcaccttgccgcaggtttcctggatcgtggcgccg
gccgattactccgaacatcccgggccctccagcccggtccagggcgcctggtatatacag
gccgcgctcgatgccttgacctccaatcccgccatctggagcaagacggtatttctgatc
aacttcgacgaaaacgacggctatttcgatcatgtcccgccgccggcagcgccctcgatc
aatcctgacggctctatggccggcgcctcaacggttaacaccgatctggagcgccatacc
cgcgcctcggtctcggacgcgcccgacaaccgcgtttatggccccgggccgcgcgtgccc
atgtacgtggtctcgccgtggagccgtggcggttgggtgaactcgcaagctttcgatcac
acgtcggtgttgcgcttcctggaggcccgtttcggggtggcagagctgaatatcagcccc
tggcgccgtgcggcgatgggtgatctgacctcggcgttcaacttcgtgacgcccaatgac
gacacgctgcccaatctgaacctgttgactcgcggcggctctgaccagttgcgcgccgac
caacaggctaaagctgccgtaccgctgcccgccgaagccaaccaggtcaagccggtgcaa
gagccgggcgtgcgtccctcgcgcgccttgccttacgagttgcacaccagcgcccgaacc
cagtccagttcgggcgccatatggctcatcttcgccaatacgggtgaggccaccggcgtg
ttccatgtctatgaccgcctgcatctggaccgtctgccgcgccgctacacggtcgagcct
ggcaaacaactggaaggcagttgggatgctagcgccgacggcggcaaatacgacctctgg
gtgctcggccccaacggctatcaccgccacttcacgggcgatcttgccctggcgcgcacc
gcagcgctcgacgccgaaacgcgagtctgctacgacatcgccaatggtgacgtctacgtc
acgctcagcaacaacggcaaaaccgcctgcaatttcgacatcacgcctaacgcctactac
gtcaacaacgaacgttggacgctgaccgtccccccgggcggcaaggtcgatcagcactgg
gctctggccaacagcggcgcctggtacgacttcaccgtgcgcatgacggaagacccgagc
tatgcgcgccgtttcgccggccgcgtggaaaccggcaaaccctcggtcaccgacccggcc
atgggccaataa

DBGET integrated database retrieval system