KEGG   Bordetella avium: BAV1882Help
Entry
BAV1882           CDS       T00695                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bav  Bordetella avium
Pathway
bav00564  Glycerophospholipid metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
Module
bav_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAV1882 (psd)
Enzymes [BR:bav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     BAV1882 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CAJ49491
UniProt: Q2L0K8
Position
1979369..1980253
Genome map
AA seq 294 aa AA seqDB search
MSIKDQIFLASQHLAPHHLVSRGMGLLADSRIPALKNAMISRFVQRYNVDMSEALVEDPL
AYPCFNDFFTRALKPDARPLDDDSANVLSPADGTISQLGPIREGRIFQAKGHSFGLTALL
GGDAERAAPFEGGDFATIYLSPRDYHRVHMPVTGTLREMVHVPGRLFSVNPLTANTVPDL
FARNERVVCIFDTAYGPMAVILVGAMIVASVETVWAGLVTPHKREVRSTRYGPQEPIVLE
RGAEMGRFKLGSTAIVLFGPGRIRWFDTPSVRGPIRMGETLALPANHLEDVPAV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaaagaccagatctttctcgccagccagcatctcgcgccccatcaccttgtg
tcccggggcatgggcctattggccgacagccgtattccagcgctgaagaacgccatgatc
tcgcgcttcgtgcagcgctataacgtcgatatgagcgaggccctggtcgaagatccattg
gcctatccctgcttcaatgatttcttcacccgcgcgctcaagccggatgcgcggcctctc
gatgacgatagcgccaatgtcctgtctccggccgatggcaccatcagccaactgggtccc
atccgcgagggccgtattttccaggccaaggggcacagcttcggcctgaccgccctgctg
ggcggagatgcagaacgcgccgcgccctttgaaggcggcgatttcgccaccatctacctg
tctccgcgcgactatcaccgagtgcacatgccggtgacgggcacgctgcgcgaaatggtg
cacgtgccgggccgcctgttttcggtcaaccccctgaccgccaacactgtgcccgatctc
tttgcccgtaacgaacgggtcgtgtgtattttcgacacggcctatggccccatggctgtc
atactggtcggcgccatgattgtggcctcggtggaaacggtctgggccggactggtcacg
ccgcacaagcgcgaagtccgcagcacgcgctacggcccgcaagagcccatcgtcctggag
cgcggcgccgaaatgggccgtttcaagctcggctcgactgcaatcgtgttgtttggccct
ggccgtatccgctggtttgacacgccttcggtacgcggcccgatccgcatgggtgagacc
ctggcgctacccgccaaccaccttgaagacgtgccggcggtttga

DBGET integrated database retrieval system