KEGG   Bordetella avium: BAV2162Help
Entry
BAV2162           CDS       T00695                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bav  Bordetella avium
Pathway
bav00260  Glycine, serine and threonine metabolism
bav00750  Vitamin B6 metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01120  Microbial metabolism in diverse environments
bav01230  Biosynthesis of amino acids
Module
bav_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAV2162 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAV2162 (thrC)
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAV2162 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: CAJ49771
UniProt: Q2KZ40
Position
complement(2323478..2324887)
Genome map
AA seq 469 aa AA seqDB search
MKYVSTRGGMAPLDFSDILLEGLAPDGGLAVPQELPHIDAATLESWRGLSYAELALEVLS
RFATDIPKDDLCQLTAAAYNGRVFSSDEIVPLRPLADGLQLLGLSEGPTLAFKDMAMQFL
GQVFEYVLTKRGTTLNIVGATSGDTGSAAEYALRGKRGVGVFMLSPHGRMSAFQRAQMYS
LQDENIHNIAVKGVFDQAQDIVKALAGDLAFKARYRIGAVNSINWARIASQVVYYFHGWL
RATRTAGQEVSFAVPSGNFGNILSGHIARRMGLPVRRLVLATNENNVLEEFFRTGVYRPR
GPEQTYATSSPSMDISRASNFERFIYDLLDGDGERVRALWNELAQKGSFDLSAYRDDFLT
RYGFVSGVSTHEDRLATIRTIFDETGVLIDPHTADGVKVARDFVEPGVPMLVLETALPAK
FSDTIEEALGRSVPPPGELADLESLPQRVTVMDCDVDQVRAFIEKHAKV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgtatcgacccggggcggcatggcgcccctggacttctccgacattctgctt
gagggtctggcgccggacggcggtctggccgtgccgcaggaactgcctcacatcgatgcc
gccacgctagagtcctggcgcgggctgtcttatgccgagttagccctggaagttctgtcg
cgttttgccaccgatattcccaaggatgatctgtgtcagctgacggccgctgcctataac
ggcagggttttttccagtgatgagatcgtgcccttgcggccgctcgccgatggcctgcaa
ttgctgggtttgtctgaaggcccgacgctggctttcaaggacatggccatgcagtttctc
ggccaggtcttcgaatacgtgctgaccaagcgcggcacgacgctgaatatcgtcggggcc
acctccggcgatacgggctccgccgccgagtatgccttgcgcggcaagcgtggcgtaggc
gtgttcatgctttctccgcatggccggatgagcgctttccagcgcgcccagatgtactcc
ttgcaagatgagaacatccacaatattgcggtcaagggtgttttcgatcaggcccaggat
atcgtcaaggctctggccggcgatctggctttcaaggcgcgctaccgcatcggcgccgtg
aactcgatcaactgggcgcgtatcgcctctcaggtggtgtactacttccatggctggctg
cgcgctacccgcacagcgggtcaggaagtgtcttttgccgtgccctctggcaattttggc
aatattctctcgggtcatatcgcccgccgcatgggtttgccggttcgacgcctcgtgctg
gctaccaacgagaataatgtgctggaagagttcttccgcaccggggtttaccgcccgcgc
gggccagagcagacctacgcgacgtccagcccctccatggacatttcgcgcgcttccaat
ttcgagcgtttcatctacgatctgctagatggcgacggtgagcgtgtgcgcgcgctctgg
aatgagttggcgcagaagggcagcttcgatctgtcggcctatcgagacgacttcctgacc
cgatatggatttgtgtcgggcgtgagcacgcacgaagatcgcctggccacgatacgtacc
atcttcgacgagaccggcgtgctgatcgatccgcataccgccgatggcgtgaaagtggcg
cgtgacttcgtcgagccgggggttccgatgctggtcctcgagacggctttgcccgccaag
ttctccgataccattgaagaggctctgggtcgcagcgtgccgccgccgggcgagttggcg
gatctggagtccttgccgcagcgcgtgaccgtgatggattgcgatgttgaccaggtgcgg
gcttttatcgagaagcacgccaaagtctga

DBGET integrated database retrieval system